KEGG   Danio rerio (zebrafish): 30654
Entry
30654             CDS       T01004                                 

Gene name
gsk3ba
Definition
(RefSeq) glycogen synthase kinase-3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04110  Cell cycle
dre04150  mTOR signaling pathway
dre04310  Wnt signaling pathway
dre04340  Hedgehog signaling pathway
dre04510  Focal adhesion
dre04910  Insulin signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    30654 (gsk3ba)
   04310 Wnt signaling pathway
    30654 (gsk3ba)
   04340 Hedgehog signaling pathway
    30654 (gsk3ba)
   04150 mTOR signaling pathway
    30654 (gsk3ba)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    30654 (gsk3ba)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    30654 (gsk3ba)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    30654 (gsk3ba)
   04916 Melanogenesis
    30654 (gsk3ba)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    30654 (gsk3ba)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    30654 (gsk3ba)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     30654 (gsk3ba)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   30654 (gsk3ba)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    30654 (gsk3ba)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 30654
NCBI-ProteinID: NP_571456
ZFIN: ZDB-GENE-990714-4
Ensembl: ENSDARG00000017803
Vega: OTTDARG00000025874
UniProt: Q9YH60
LinkDB
Position
9
AA seq 421 aa
MSGRPRTTSFAESCKPVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELREPNVKLPNGREKPSLF
NFTTQELSSNPTLASILIPAHARNQAGASTPTNPSATSDANSGDRSQTTTAASASASNTS
T
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtccggtcggcccagaaccacctccttcgcagaaagctgcaagccagtgccgcagccg
tcggcattcggcagcatgaaagtcagcagagataaagatggcagtaaagtgaccacagtg
gtggcgactcctggacagggacctgaccggccgcaggaggtcagctacactgacaccaag
gtcatcggtaacggctcttttggcgtggtctatcaggccaaactctgcgactcaggagaa
ctggtggccattaagaaggtccttcaggacaagcgatttaagaaccgtgagcttcagatc
atgaggaaattagaccactgcaacattgttcgtctgcgttacttcttctactccagtgga
gataagaaagatgaggtgtatctgaatttggttctggattatgttcctgaaaccgtgtac
agagtggcaagacactacagccgcgctaaacagactcttcccatggtttatgtgaagtta
tacatgtaccagctcttcaggagtctggcctacatccattcctttgggatctgccatcgg
gacataaaaccgcaaaatctcttgctggacccagacacagccgtgctcaaactctgcgac
tttggcagtgcaaagcagttagttcgtggagagcccaatgtgtcctacatctgctcacgg
tactacagagctcccgaactcatctttggagccaccgactacacctccagcatagatgtg
tggtctgctggctgtgtgctggctgaactgctgctcggacagcccattttcccaggtgac
agcggcgtggatcagctggtggagatcatcaaggtgttgggaactcccacacgagagcag
attcgggaaatgaacccaaactacaccgagttcaaattcccgcagattaaggcccatcca
tggactaaggtgtttcggccacgcactccccctgaagccattgccttgtgctcccggctg
ctggaatacacaccgaccgctcgactgactcctctcgaggcctgcgctcattccttcttc
gatgaactgcgggaaccaaatgtcaaacttccaaatggacgcgagaagccttccttattc
aacttcacaactcaagagctgtccagtaaccctaccctggcctccatcttaatccccgct
catgcacgtaaccaggcaggagcttcaactcccaccaacccctctgccacttcagatgcc
aacagtggagatcgcagccagacgacaactgcagcctccgcctccgcctctaacacctca
acctga

KEGG   Danio rerio (zebrafish): 557882
Entry
557882            CDS       T01004                                 

Gene name
gsk3bb
Definition
(RefSeq) glycogen synthase kinase 3 beta, genome duplicate b
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04110  Cell cycle
dre04150  mTOR signaling pathway
dre04310  Wnt signaling pathway
dre04340  Hedgehog signaling pathway
dre04510  Focal adhesion
dre04910  Insulin signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    557882 (gsk3bb)
   04310 Wnt signaling pathway
    557882 (gsk3bb)
   04340 Hedgehog signaling pathway
    557882 (gsk3bb)
   04150 mTOR signaling pathway
    557882 (gsk3bb)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    557882 (gsk3bb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    557882 (gsk3bb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    557882 (gsk3bb)
   04916 Melanogenesis
    557882 (gsk3bb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    557882 (gsk3bb)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    557882 (gsk3bb)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     557882 (gsk3bb)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   557882 (gsk3bb)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    557882 (gsk3bb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Choline_kinase ABC1
Other DBs
NCBI-GeneID: 557882
NCBI-ProteinID: NP_001139160
ZFIN: ZDB-GENE-090312-2
Ensembl: ENSDARG00000052468
Vega: OTTDARG00000030030
UniProt: B8JIQ1
LinkDB
Position
1
AA seq 419 aa
MSGRPRTTSFAESCKPVPQPSAFGNMKVSRDKDGSKVTTVAATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDTGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVMDYVPENVYRVARHYSKAKQNLPMVYVKLYMYQLFRSLAYIHSYGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDI
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHTFFDELREPNLKLPNGRERPVLF
NFTTQELSNNPSLASVLIPAHAQNQAENSTQSASAATGANSGDRGLNTNAASAAPNPST
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgtcaggccggcctaggaccacctcattcgcggagagctgcaagccagtgccgcagcct
tcagcctttggcaacatgaaagtcagcagagataaagacggcagtaaggtgacgacagtg
gccgcgacccccggtcagggtcccgaccggcctcaggaggtcagctatacggacacaaag
gtcattggaaacggctcatttggggtcgtatatcaggccaagctttgtgacaccggcgag
ttggtggccataaagaaggtgctgcaggataaaaggtttaagaatcgtgagttacagatc
atgaggaaactcgatcactgtaacatcgtccgtctgcggtatttcttctactccagtgga
gataaaaaggatgaggtgtacctgaatttggtgatggattacgtgcctgagaacgtgtac
agagtggccagacactacagcaaagccaagcagaatctgcccatggtttatgtgaagctg
tatatgtatcagctgttccgcagtttggcgtacatccattcatatgggatctgccatcga
gacatcaagccgcagaacctcctgctggaccccgagacagctgtacttaaactctgtgat
ttcggaagtgcaaagcagctggtgcgtggagagcctaatgtctcctacatctgctcgcgg
tactacagggcccctgaactcattttcggagccactgactacacttccagcatagatatt
tggtcagctggttgtgtattggccgagctgctgcttggacagcccatttttcctggtgac
agcggtgtcgatcagcttgttgagatcattaaggtgctgggaactcctacacgagagcag
attcgggagatgaatccaaattacactgaattcaagtttccacagatcaaggcgcaccca
tggacgaaggttttccggccccggacccctccggaggcgatcgctctgtgttcgcgattg
ttggagtatactcctacagcccgtctaactcctctggaagcctgcgctcacactttcttc
gacgagctccgtgagccaaacctcaagctccccaatggaagagaacggcctgtgctgttt
aatttcaccacacaggagttgtccaataacccctcgctggcgtctgtactgatccctgca
catgctcagaaccaggccgaaaactctacccagtctgcctcagccgcaacaggtgccaac
agtggtgatcgtggtctgaacaccaacgctgcctctgccgctccgaatccttcaacttga

DBGET integrated database retrieval system