KEGG   Danio rerio (zebrafish): 30686
Entry
30686             CDS       T01004                                 

Gene name
myca
Definition
(RefSeq) transcriptional regulator Myc-A
  KO
K04377  Myc proto-oncogene protein
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04110  Cell cycle
dre04218  Cellular senescence
dre04310  Wnt signaling pathway
dre04350  TGF-beta signaling pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    30686 (myca)
   04012 ErbB signaling pathway
    30686 (myca)
   04310 Wnt signaling pathway
    30686 (myca)
   04350 TGF-beta signaling pathway
    30686 (myca)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    30686 (myca)
   04218 Cellular senescence
    30686 (myca)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    30686 (myca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    30686 (myca)
   03019 Messenger RNA biogenesis [BR:dre03019]
    30686 (myca)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    30686 (myca)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     30686 (myca)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH NOA36 Ribosomal_60s
Other DBs
NCBI-GeneID: 30686
NCBI-ProteinID: NP_571487
ZFIN: ZDB-GENE-990415-162
UniProt: P52160
LinkDB
Position
24
AA seq 419 aa
MERHSLNTSVKMPVSASLACKNYDYDYDSIQPYFYFDNDDEDFYHHQQGQTQPSAPSEDI
WKKFELLPTPPLSPSRRQSLSTAEQLEMVSEFLGDDVVSQSFICDDADYSQSFIKSIIIQ
DCMWSGFSAAAKLEKVVSERLASLHAERKELMSDSNSNRLNASYLQDLSTSASECIDPSV
VFPYPLTECGKAGKVASPQPMLVLDTPPNSSSSSGSDSEDEEEEDEEEEEEEEEEEEEEE
EEEIDVVTVEKRQKRHETDASESRYPSPLVLKRCHVSTHQHNYAAHPSTRHDQPAVKRLR
LEASNNHSINSSSSNRHVKQRKCASPRTSDSEDNDKRRTHNVLERQRRNELKLSFFALRD
EIPEVANNEKAAKVVILKKATECIHSMQLDEQRLLSIKEQLRRKSEQLKHRLQQLRSSH
NT seq 1260 nt   +upstreamnt  +downstreamnt
ctggaacggcattcgttaaacacaagtgtcaaaatgccggtgagtgcgagtttggcgtgt
aaaaactacgattacgactacgactccatccagccctacttctacttcgacaacgacgat
gaggatttttatcaccatcagcaaggacagactcaaccttcagcccccagcgaggacatt
tggaagaaattcgaactgctgcccacaccgcccctctcgcccagccggagacagtcgctc
tccaccgcggaacagctggagatggtcagcgagttcctgggagacgacgtggtcagccag
agcttcatctgcgatgatgcggactactcccagtccttcatcaagtccatcatcatccag
gactgcatgtggagcggcttttccgccgctgccaagttggagaaagtggtttcagagaga
ctggcgtctttgcacgctgaaaggaaggaactgatgtctgacagcaactcaaatcgacta
aacgcgagctatttgcaggatctgagcacctctgcatcagaatgcatcgatccctctgtg
gtcttcccatatcctctgacagagtgtgggaaagccggcaaggttgcatcaccacagccc
atgctggtcctggacactccacctaacagctccagcagcagtggcagcgattcagaagat
gaagaagaagaggatgaggaggaggaagaagaagaggaggaggaagaagaggaggaagag
gaggaagaaattgatgtggtgactgtggaaaagcgacagaaaaggcacgagacggatgct
tcagagtcgaggtaccccagtcccctagttttgaagcgctgtcacgtctccacccaccag
cacaactacgccgcccatccgtcaacgcggcatgaccagcctgctgtcaagaggctacga
cttgaggctagcaacaatcacagcatcaacagcagcagcagcaacaggcatgtgaagcag
cgcaagtgtgcgagtcctcgcacatcggattctgaggacaatgacaaacgcaggactcac
aatgtgctggagcgacagcgcaggaatgaactcaaactcagctttttcgcgctacgggat
gagatccctgaggtcgcaaataacgagaaagctgctaaagtggttatcctaaagaaggcg
acagagtgcatccacagcatgcagttggacgagcagaggctgctgtccatcaaagaacag
ctgaggcgaaagagcgaacagttaaaacacaggcttcagcagctgcggagttcacattaa

KEGG   Danio rerio (zebrafish): 393141
Entry
393141            CDS       T01004                                 

Gene name
mycb
Definition
(RefSeq) transcriptional regulator Myc-B
  KO
K04377  Myc proto-oncogene protein
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04110  Cell cycle
dre04218  Cellular senescence
dre04310  Wnt signaling pathway
dre04350  TGF-beta signaling pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    393141 (mycb)
   04012 ErbB signaling pathway
    393141 (mycb)
   04310 Wnt signaling pathway
    393141 (mycb)
   04350 TGF-beta signaling pathway
    393141 (mycb)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    393141 (mycb)
   04218 Cellular senescence
    393141 (mycb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    393141 (mycb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    393141 (mycb)
   03019 Messenger RNA biogenesis [BR:dre03019]
    393141 (mycb)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    393141 (mycb)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     393141 (mycb)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ GOLD_2
Other DBs
NCBI-GeneID: 393141
NCBI-ProteinID: NP_956466
ZFIN: ZDB-GENE-040426-780
Ensembl: ENSDARG00000007241
Vega: OTTDARG00000021596
UniProt: Q7ZVS9 B2GQB7
LinkDB
Position
2
AA seq 396 aa
MPLNSSMECKNYDYDYDSYQPYFYFDNEDEDFYNHQHGQPPAPSEDIWKKFELLPTPPLS
PSRRPSLSDPFPSTADKLEMVSEFLGDDVVNHSIICDADYSQSFLKSIIIQDCMWSGFSA
AAKLEKVVSERLASLQAARKESSRTESADICRSVGFLQDMSTPASQCIDPSVVFPFPLTD
STKPCKPAPTPASTTLPLDTPPNSGSSSSSSDSESDDEDDEDEEEEEEIDVVTVEKRKSV
KKSDANATHQSPVVLKRCHVNIHQHNYAAHPSTRNEQPAVKRIKFESHIRVFKQISHNRK
CASPRTSDSEDNDKRRTHNVLERQRRNELKLSFFALRDVIPDVANNEKAAKVVILKKATE
CIASMQEDEQRLISLKEQLRRKCEHLKQRLEQLSCS
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgccgctgaattcaagtatggagtgtaaaaattatgattacgactacgactcctaccag
ccctatttctattttgacaacgaggacgaggatttctataaccatcagcacggacagcca
ccggcgcccagtgaggatatatggaagaaatttgaactgctgcccacccctccgctctcc
ccgagccggcgaccctccctgtcagaccccttcccgtccacagccgacaagctcgagatg
gtgtcggagtttttgggggacgatgtggtcaaccacagcattatttgtgacgcggactac
tcccagtcgtttctgaaatcgattatcattcaggactgtatgtggagcggtttctccgca
gcggctaagctggagaaggtggtgtcggagagattagcgtcgctccaggcggcgaggaag
gagtcatccaggaccgagtccgcggacatctgtcggtctgtcggcttcctccaggacatg
agcacccctgcctcccagtgcattgacccgtccgtggtgtttccctttccactgacggac
agcacaaagccgtgcaaacccgcgcccacgccggcttccacaacacttccactggatact
ccgccaaacagtgggagtagcagcagcagtagtgacagcgaatccgatgacgaagatgat
gaagatgaagaagaggaggaagaaattgacgtggtcacggtggaaaagagaaagtcggtg
aaaaagtctgacgcgaacgcaacgcatcaaagcccggtcgtcctcaagcggtgtcacgtt
aacattcaccaacacaactacgccgcccatccgtccacgcggaatgagcagcctgcagtc
aagcggattaaattcgagagccacatccgggtgtttaaacaaattagccataaccgaaaa
tgcgcgagtcccaggacgtcggactctgaggataacgataagcggaggactcataatgtg
ctcgagcggcagcggcggaacgagctcaaactgagcttcttcgcgctgagggacgtcatt
cctgacgtggcgaacaacgagaaagcggccaaagtggtgatcctgaagaaggcgacggag
tgcatagcgagcatgcaggaggatgaacaaagactgatctcacttaaggagcagttgagg
aggaaatgtgaacatttgaaacagagactcgagcagttgagctgttcttaa

DBGET integrated database retrieval system