KEGG   Danio rerio (zebrafish): 30716
Entry
30716             CDS       T01004                                 

Gene name
raf1a
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase a
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04270  Vascular smooth muscle contraction
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04916  Melanogenesis
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    30716 (raf1a)
   04012 ErbB signaling pathway
    30716 (raf1a)
   04370 VEGF signaling pathway
    30716 (raf1a)
   04371 Apelin signaling pathway
    30716 (raf1a)
   04068 FoxO signaling pathway
    30716 (raf1a)
   04150 mTOR signaling pathway
    30716 (raf1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    30716 (raf1a)
  09143 Cell growth and death
   04210 Apoptosis
    30716 (raf1a)
   04218 Cellular senescence
    30716 (raf1a)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    30716 (raf1a)
   04540 Gap junction
    30716 (raf1a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    30716 (raf1a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    30716 (raf1a)
  09152 Endocrine system
   04910 Insulin signaling pathway
    30716 (raf1a)
   04912 GnRH signaling pathway
    30716 (raf1a)
   04914 Progesterone-mediated oocyte maturation
    30716 (raf1a)
   04916 Melanogenesis
    30716 (raf1a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    30716 (raf1a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    30716 (raf1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    30716 (raf1a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     30716 (raf1a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   30716 (raf1a)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 Big_2 zf-RING_2 zf-C3HC4_2
Other DBs
NCBI-GeneID: 30716
NCBI-ProteinID: NP_571514
ZFIN: ZDB-GENE-990415-41
Ensembl: ENSDARG00000096415
UniProt: A0A0R4IN14
LinkDB
Position
23
AA seq 643 aa
MEQLQGAWRTVTNGLLTKDSVFESSYVSPVIKSPAPCQSRSSDDSKTSRTIRVFLPNQQR
TVVNVRPGMTLHSCLIKALKVRGLQPECCAVFSLHPGQRSKKSRMEWSTDSTSLIGEELL
VEVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQRCGYKFHEHCSTKVPTMCVDW
TNIRQLLLFPTPGESGAPSLPSLTSRRMRESLTRIPSSSVHRYSNPHVSNYTSPYPPSGA
ALTQRLRSTSTPNVTMLSTTVPVDSSLIELDTSPSSWCQQFSLKRRDAIRVHSSAGSSPN
QSPTGWNQASAHIPASALNPQEKVKIRPRDKRDSSYYWEIEANEVVLLSRIGSGSFGTVH
KGKWHGDVAVKVLKVTNPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKGNLAIVTQWC
EGSSLYKHLHVLETNFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKI
GDFGLATVKARWSGSQQVEQPSGSILWMAPEVIRMQDNNPYSFQSDVYSYGIVLFELMTG
ELPYSQIGNRDQIIFMVGRGYLSPDLSKLYKRCPKAMKRLVADCIKKSKDERPLFPQILS
SIELLQHSLPKINRSASEPSLHRASQSEDISSCTLTSMKLPVF
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggagcagcttcagggagcatggagaaccgtcaccaacgggctgctaaccaaagattca
gtgtttgaaagctcctacgtgtctcctgtgatcaaatctcctgcgccatgccagagccgc
tcttcagacgactccaaaaccagccgcaccatccgagtcttcctgcccaaccagcagcgg
acagttgtgaatgtgcggccaggcatgacgctccacagctgtctgatcaaagcgctgaag
gttcgaggactccagccggagtgctgtgctgtcttcagtctccatcctggacagagaagc
aagaagtctcgcatggagtggagcacagactctacctcactcattggggaggaacttctc
gtggaggttttagaccatgttcctttaacaacacacaattttgttagaaaaacatttctc
aagttggctttctgcgacatatgccagaagttcctgctgaatggtttccggtgccaaaga
tgtggttacaagttccatgaacactgcagcacaaaagtgcccactatgtgtgtagactgg
actaacatcagacaacttctattgtttccgacccctggtgaaagtggggctccatctcta
ccttcactcacatctaggagaatgagggaatctctgacaagaatccccagcagctctgtg
cacagatattcaaaccctcatgtctccaattacaccagcccttaccctccctctggagcg
gctctgacacagagactgcggtccacatccacacccaacgtcaccatgctcagcaccaca
gtgccagttgacagcagcctgattgagttagacacatctccaagctcctggtgtcaacag
tttagtctgaagagaagagatgccatacgtgttcacagctcagctggcagttctccaaat
cagagccctaccggctggaaccaggccagcgcacacataccagcatcagctctaaatcct
caggagaaagttaaaatccggccgagggataaacgggactcgagttattactgggagatc
gaagctaatgaggttgtgctactgagcaggattgggtcaggctcctttggaaccgtacac
aaagggaaatggcacggtgatgtggctgtgaaggtattaaaagtcaccaacccaacacca
gagcagtttcaggctttccgcaacgaggtggcagttcttaggaaaaccagacatgtcaac
attctgttgttcatgggctacatgacaaaaggaaatcttgccattgtaacgcagtggtgt
gaaggcagcagtctgtataaacacctccacgtactggagaccaacttccagatgtttcag
ctgatagatatcgccagacagactgctcagggcatggactatctacatgcgaaaaacatc
atccaccgtgacatgaaatccaacaacatcttcttacatgaaggcctgacagtgaagatt
ggagattttggactggcaaccgtgaaggccaggtggagtggttctcaacaggtggaacaa
ccttcaggatctattttatggatggcacctgaggtgatccgaatgcaggacaacaacccc
tacagtttccaatcagatgtgtattcgtatggcatcgtgctgtttgagttaatgacaggg
gagctgccctactcacaaatagggaaccgagatcagatcattttcatggtaggtcgagga
tatctgtctccagacctcagtaaactgtataagagatgtcctaaagccatgaagagactg
gtggctgactgtatcaaaaagtccaaggacgagaggcctcttttcccccagattctgtcc
tccattgagctgctgcaacactcgctgcccaaaatcaaccgcagcgcctctgaaccctcg
ctgcacagagcgtcccagagtgaagacatcagctcctgcacactcacctccatgaagctg
cccgtcttctaa

KEGG   Danio rerio (zebrafish): 403063
Entry
403063            CDS       T01004                                 

Gene name
araf
Definition
(RefSeq) serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04270  Vascular smooth muscle contraction
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    403063 (araf)
   04012 ErbB signaling pathway
    403063 (araf)
   04068 FoxO signaling pathway
    403063 (araf)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    403063 (araf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    403063 (araf)
   04914 Progesterone-mediated oocyte maturation
    403063 (araf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    403063 (araf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    403063 (araf)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     403063 (araf)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   403063 (araf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal Kdo TUG-UBL1 APH
Other DBs
NCBI-GeneID: 403063
NCBI-ProteinID: NP_991306
ZFIN: ZDB-GENE-050102-2
Ensembl: ENSDARG00000054533
Vega: OTTDARG00000026948
UniProt: Q75Y03
LinkDB
Position
5
AA seq 608 aa
MSNTSSCSSSGETSPDDTPRGGGTIRVYLPNKQRTVVNVRPGQTVYDSLDKALKVRGLSQ
DCCAVFRLLEGRKRLTEWDTDITPLVGEELLVEVLDDVPLTMHNFVRKTFFKLAYCDFCH
KFLFNGFRCQTCGYKFHQHCSSKVPTVCVDMDTMTKRCVNNTEDCPAILIYPATNSISQS
DLPLTSDSPGGELPSSPSNFCLFIRGEDGQSLQRHRSTSTPNVHMVSTLEPGAAGLLEEP
FKISTVASYTGYESSPKPSTSPPHLGSPGRKPPKSPSEPKERKQSSSDDKKKVHRGGYRD
SSYYWEVHPREVSMLKRIGAGSFGTVFKGKWHGDVAIKILKVTEPTPEQLQAFKNEMQVL
RKTRHVNILLFMGFMTRPNFAIITQWCEGSSLYRHLHVTETKFDTMRRIDVARQTAQGMD
YLHAKNIIHRDLKSNNIFLHEGWTVKIGDFGLATVKSRWSGSQQVEQPSGSILWMAPEVI
RMQDTNPYTFQSDVYGYGVVLYELMSGTLPYSNINNRDQIIFMVGRGYLSPDLSKLYSNC
PKSMKRLIIDCLKFKRDERPLFPQILVSIEQVQELLPKIERSASEPSLHRAVHAEDLNPL
LLHTTRFL
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgtccaacacttcctcctgttcctcctcgggggaaaccagcccggacgatacaccccga
ggtggaggcaccatccgcgtctacctccctaacaagcagcggacggtggtaaacgttcgg
cctgggcaaactgtgtatgatagtttagataaagccctaaaagtccgaggcctaagccag
gattgctgtgctgtctttcgcctgcttgaaggccggaagagacttacagaatgggacact
gacatcacacccctcgtgggggaagagctactggtagaagtcctggatgatgttcccctt
accatgcacaactttgtacgtaaaacgttctttaagttagcatactgtgacttctgccac
aagttcttattcaacggcttcaggtgtcagacatgtggatataaatttcaccagcactgc
agcagtaaagtccctacagtatgtgtggacatggacacaatgacaaaacggtgtgttaat
aatacagaagactgccctgcgatattgatatatccggccaccaattccatatcgcagagc
gacctacctttaacctcagattctcctggaggggagctgccgtcttccccgtcaaacttc
tgtttgttcattcgaggagaggacggtcagtctctccagaggcatcgatcaacctcaaca
cccaatgttcacatggtcagcacgctggagcctggcgctgctggccttttggaggagcca
ttcaaaatcagcacagtggcgtcctacacagggtacgagtcctctcccaaaccttccact
agcccaccccacctagggtcgccaggaagaaaaccccccaaatccccttctgaacccaag
gaacgaaagcagtcctcgtctgatgataaaaagaaagtgcaccggggaggttacagagac
tccagttactactgggaggtgcacccgcgggaggtgtccatgttaaagaggattggagca
ggctcttttgggaccgtctttaaaggcaagtggcatggagacgtggccatcaaaattctt
aaagtgacagagcccacaccggagcagctccaggcctttaaaaatgagatgcaggtttta
cgaaaaacacgccatgtaaacattctgctgtttatgggcttcatgacaaggcctaatttt
gccattatcacacagtggtgtgaaggcagcagtctgtatcgccatctgcatgtcactgag
accaagtttgacaccatgcggcgcattgatgttgctcgccaaacagcacagggcatggat
tatcttcacgccaagaatatcattcatcgggacttgaaatctaataatatcttcctgcat
gaaggctggacagtaaaaatcggtgactttggcttggctacagtaaagtctcgctggagt
ggctcacagcaggtcgaacagcccagtggctccatcctgtggatggctcctgaggtgatc
agaatgcaagacactaacccgtacaccttccagtctgatgtgtatggatatggagtggtg
ctctacgaactgatgtctgggactttgccttattcgaatatcaacaaccgcgatcagatt
attttcatggtgggtcgtggttacttgtctccagacctcagtaaattatacagtaactgc
ccgaaatcaatgaagaggctcatcattgactgtctgaaattcaaacgggatgaacggcct
ctctttccacagatcctggtgagcattgagcaggtccaggaattgttgccaaaaatcgag
cggagtgcctctgagccctctctacaccgtgctgtacatgccgaggacctgaatccgctt
ctccttcacaccacgcgcttcctgtga

KEGG   Danio rerio (zebrafish): 403065
Entry
403065            CDS       T01004                                 

Gene name
braf
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform 1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04150  mTOR signaling pathway
dre04270  Vascular smooth muscle contraction
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    403065 (braf)
   04012 ErbB signaling pathway
    403065 (braf)
   04068 FoxO signaling pathway
    403065 (braf)
   04150 mTOR signaling pathway
    403065 (braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    403065 (braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    403065 (braf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    403065 (braf)
   04914 Progesterone-mediated oocyte maturation
    403065 (braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    403065 (braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    403065 (braf)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     403065 (braf)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   403065 (braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 403065
NCBI-ProteinID: NP_001311445
ZFIN: ZDB-GENE-040805-1
Ensembl: ENSDARG00000017661
Vega: OTTDARG00000007629
UniProt: Q1LYG2
LinkDB
Position
4
AA seq 817 aa
MAALSSAESPPPVFNGDTMNRDPERDPGLDELGAGLEPACPGEAAIPECQQGIPEEIWNI
KQMIKLTQEHLEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEAIGNGTEFC
SSPTPTLLDVKGQGIQSAPTAPNTLAVLQTPTDATRGNPRSPQKPIVRVFLPNKQRTVVP
ARCGMTVRDSLKKALMMRGLIPECCAVYRVQDGEKKPIGWDTDISWLTGEELHVEVLENV
PLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLL
ASKFLVHHPITQEEVSSEGTTPISEMCPSLPPSESTGSLCHPTVSPSKSIPIPQSFRPGE
EDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGLPRSDGAPSQHPARCLRKNRTRT
SSPLLSSHPNDIVFDFEPEPVFRGSTTGLSATPPASLPGSLPNVKVSKSPCQPRERKPSS
SSEDRNKMKTLGRRDSSDDWEIPEGQITLGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAP
TPQQLQAFKNEVGVLRKTRHVNILLFMGYTTKPQLAIVTQWCEGSSLYHHLHIIETKFEM
IKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQF
EQLSGSILWMAPEVIRLQDKNPYSFQSDVYAFGIVLYELMSGALPYSNINNRDQIIFMVG
RGYLSPDLSKVRSNCPKAMKRLMADCLKKKREERPLFPQILASIELLARSLPKIHRSASE
PSLNRAGFQTEDFSLYTCASPKTPIQAGGYGEFTAFK
NT seq 2454 nt   +upstreamnt  +downstreamnt
atggcggcgttgagcagcgccgagtccccaccgcccgtcttcaacggagacaccatgaac
cgcgatccggagcgggacccgggactggacgagctgggcgcggggctcgaacccgcctgt
cccggagaagcggcgatccccgaatgtcaacagggcattcccgaggagatatggaatatt
aaacagatgattaagttaactcaagagcacctagaagcccttttagataagtttggagga
gaacacaatccaccgtctatatatctagaggcctatgaggagtacactagtaagctggat
gcattacagcagcgggagcagcagcttttggaagctattgggaatgggaccgagttctgc
tcctcgccgacacccaccctgctggacgtgaagggacagggcattcagagtgcccccact
gccccaaacaccctagctgtcctgcagacgcccactgacgcaacacgaggcaatccccgc
tcgccccagaaacccatcgtcagggtcttcctgcccaacaaacagaggactgtggttcca
gctcgttgtgggatgacggtcagagactccttaaagaaggctctgatgatgcgaggcttg
atcccagaatgctgtgcagtctatagagttcaggatggggagaagaagcccattggctgg
gacacagacatttcctggttgacgggggaggagcttcacgttgaagttttagaaaatgtg
ccactgacgacccataattttgtgcgaaagaccttcttcacgctggccttctgtgatttt
tgccggaagctgttgtttcaaggcttccgctgtcagacgtgtggctataagtttcaccag
cgctgcagcacggaggtcccactcatgtgtgtcaactacgatcagctggatttattgctg
gcatcaaaatttctggtgcaccaccccatcacccaggaggaggtgtcatcagagggcacg
acacccatttcagagatgtgcccctcgctaccaccatccgaatctactggctctctgtgc
catcctactgtgtccccgtccaaatccatccctatcccgcaatcttttagacctggagaa
gaggaccaccgtaaccagtttggtcagagggatcgctcctcatcagcccctaacgtccat
atcaacaccattgagccggtcaacattgatgatttgattcgtgatcaaggcttaccgagg
tcagatggagccccctcgcaacacccagcccgctgcttgaggaagaaccgaacacggacc
tcaagcccccttctgtcctcccaccccaatgacattgtctttgattttgagcctgagcca
gtgttcagaggctcaacaacaggcctgtccgccactccccctgcctccctgccaggttcc
ctgcccaatgtgaaggtgtccaaatctccgtgccaaccgagggagaggaagccatcgtct
tcatctgaggaccgcaataaaatgaaaactctgggtcgacgggactcgagcgatgattgg
gagattccagaagggcagattactctgggccagcggataggatctggttcttttgggaca
gtttacaaggggaaatggcacggtgacgtggcggtaaagatgttgaatgttacagctccc
actccacagcagctacaagcctttaagaatgaagtgggtgtcctcaggaaaacccgtcat
gtgaatatcctgctgttcatgggctacaccaccaaaccccagctggctattgttactcag
tggtgcgaaggctcgagtctctaccaccacctgcacatcatcgagaccaagttcgagatg
atcaagctgatcgacattgcccgacagacagctcagggcatggactatctgcacgcaaag
tccatcatccatagagatctgaagagtaacaacatctttttgcacgaggatttaacggta
aagattggagatttcggtctggctacagtgaagtcccgctggagcggatcacaccagttt
gagcaactttcaggctctatcttgtggatggctccagaagtgatcagactgcaggataaa
aacccatatagtttccagtcggacgtctacgcattcggcatagtgctttatgagcttatg
tcaggggctttgccttattcaaacatcaacaacagagaccagattatcttcatggttggc
cggggttacttgtctcctgacttgagcaaggtgcgcagcaattgtcctaaggccatgaag
agacttatggcagattgtctaaagaaaaagcgagaagaaagacctcttttccctcagatc
ttggcctccatcgagttattggcacgctctctgcccaaaatccaccgcagcgcctctgaa
ccgtctctgaaccgcgctggcttccagacggaggacttcagcctatacacctgcgcttcc
cccaaaacacccattcaggccggtggctatggtgaattcacagcgtttaaatag

KEGG   Danio rerio (zebrafish): 557109
Entry
557109            CDS       T01004                                 

Gene name
raf1b
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04270  Vascular smooth muscle contraction
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04916  Melanogenesis
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    557109 (raf1b)
   04012 ErbB signaling pathway
    557109 (raf1b)
   04370 VEGF signaling pathway
    557109 (raf1b)
   04371 Apelin signaling pathway
    557109 (raf1b)
   04068 FoxO signaling pathway
    557109 (raf1b)
   04150 mTOR signaling pathway
    557109 (raf1b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    557109 (raf1b)
  09143 Cell growth and death
   04210 Apoptosis
    557109 (raf1b)
   04218 Cellular senescence
    557109 (raf1b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    557109 (raf1b)
   04540 Gap junction
    557109 (raf1b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    557109 (raf1b)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    557109 (raf1b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    557109 (raf1b)
   04912 GnRH signaling pathway
    557109 (raf1b)
   04914 Progesterone-mediated oocyte maturation
    557109 (raf1b)
   04916 Melanogenesis
    557109 (raf1b)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    557109 (raf1b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    557109 (raf1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    557109 (raf1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     557109 (raf1b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   557109 (raf1b)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 Kdo
Other DBs
NCBI-GeneID: 557109
NCBI-ProteinID: NP_001186684
ZFIN: ZDB-GENE-090826-2
Ensembl: ENSDARG00000059406
Vega: OTTDARG00000035586
UniProt: Q4V900 F1QRN2
LinkDB
Position
11
AA seq 629 aa
MEHFQGAWKSVSSHGFGCKDSVFEDSCMSPSILKTFPYRRLSDDGRIPDSKTSSTIRVFL
PNKQRTVVNVRAGMTLRNCLIKALKVRGLQPECCAVFKLQREHSAKKLRMDWSTDSTSLV
GEELLVEVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLHGFRCQTCGYKFHEHCSTKVPT
MCVDWSNIRQLLLFPTPGENGALTLPPLSSRRMQNSRFSFSPYHRYSTPNALNYITPLPS
PGVSLGHKVLSTSTPNVHMVSTTQPVDEAAYQEALRHDESGSPQNLSPTEWSKTPAPAHR
EKAPSSNTQEKRIRPREKRDSSYYWEIEATEVLLLSRIGSGSFGTVYKGKWHGDVAVKIL
KVINPTPEQLQAFRNEVAVLRKTRHVNIVLFMGYMTKVKLAIVTQWCEGSSLYKHLHVQE
TNFQMFQLMDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKARWS
GSHRVEQPSGSILWMAPEVIRMQDNNPYSFQSDVYSYGIVLYELMTGELPYSMIGNRDQI
IFMVGRGYLSPDLSKLYKSCPKAMKRLVSDCIQKTKEERPLFPQILSSIELLQHSLPKIN
RSASEPSLHRATHTEDMNVCTLALTSAFK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggagcattttcagggggcctggaagagcgtcagcagtcacggcttcgggtgtaaagac
tcagtattcgaggactcctgcatgtctcccagcatcctcaagaccttcccgtaccgtaga
ttatccgacgatggcagaatcccagactccaagaccagcagcaccatccgcgtcttcctg
cccaacaagcagcgcaccgtggtgaacgtgcgagcaggaatgacgctgcgcaactgtctc
atcaaagccctgaaagttcgaggtcttcagcctgaatgctgtgctgttttcaagcttcag
cgggaacattctgctaagaagctgcgcatggactggagcactgattctacctcactggtc
ggagaggagctgctggttgaagtcttagatcacgtgccattgaccacgcacaattttgta
cgcaaaacatttttgaagttggccttttgtgacatctgtcagaagtttcttttgcacggc
ttcagatgtcagacgtgcggatacaagtttcatgagcactgcagcaccaaagtgccaacc
atgtgtgtggactggagcaacattcgccaactcctgctgttcccgactcctggagagaac
ggggctctgaccctccctccgctctcgtcccgtcgcatgcaaaactctagattctccttc
agtccctatcacagatactcaacgccaaatgcattgaactacatcacacccctgccgtcc
cctggagtctctctgggccataaagtcttgtccacatccacacccaatgtccacatggtg
agcacaacccagccagtcgatgaagctgcttatcaggaagccttaaggcatgatgaatct
ggaagccctcaaaacttaagcccgaccgaatggtccaaaaccccagctccggctcacagg
gagaaagcgccttcgagtaacactcaggaaaaacgaatccgtcctcgagagaagagagac
tccagctactactgggagatcgaggccactgaggtgcttctgctctcccggatcggctca
ggctctttcggcacagtttacaaagggaaatggcacggtgatgttgctgtgaagatttta
aaggtcatcaatccaacaccggagcagttgcaggcctttcgcaatgaagtggctgttctc
aggaagaccaggcatgttaatatcgtcttgtttatgggctacatgacgaaggtgaagctg
gccatcgtgacgcagtggtgtgagggaagcagcctctacaaacacctgcatgtgcaggag
acaaacttccagatgttccagctgatggacatcgccagacagacggctcagggcatggat
tacctgcatgcaaagaacatcatccaccgagacatgaagtccaacaatatcttcctgcac
gagggtctgacggtgaagattggagacttcggtttggccacagtaaaggctcgctggagc
ggctctcatagagtcgagcagccgtctggatccattctgtggatggctcctgaagtgatc
cgcatgcaggataataacccgtacagcttccagtcagacgtgtactcgtacgggatcgtc
ctgtatgagctgatgaccggagaactgccttattctatgattggaaacagagatcagatc
atctttatggtgggtcggggttatctgtctccagacctcagtaagctgtataagagctgt
cctaaagccatgaagagactggtgtccgactgcatccagaagaccaaagaggagcgccca
ctcttcccacagatcttgtcctctatcgagctcctccagcattcgctccccaagataaac
cgcagcgcgtctgaaccgtcgctgcacagagccacacacaccgaggacatgaacgtctgc
acgctggcactcacctctgcctttaaatga

DBGET integrated database retrieval system