KEGG   Danio rerio (zebrafish): 30739
Entry
30739             CDS       T01004                                 

Gene name
tgfbr2b
Definition
(RefSeq) TGF-beta receptor type-2 precursor
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04060  Cytokine-cytokine receptor interaction
dre04068  FoxO signaling pathway
dre04144  Endocytosis
dre04218  Cellular senescence
dre04350  TGF-beta signaling pathway
dre04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    30739 (tgfbr2b)
   04350 TGF-beta signaling pathway
    30739 (tgfbr2b)
   04068 FoxO signaling pathway
    30739 (tgfbr2b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    30739 (tgfbr2b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    30739 (tgfbr2b)
  09143 Cell growth and death
   04218 Cellular senescence
    30739 (tgfbr2b)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    30739 (tgfbr2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    30739 (tgfbr2b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     30739 (tgfbr2b)
Protein kinases [BR:dre01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   30739 (tgfbr2b)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 30739
NCBI-ProteinID: NP_878275
ZFIN: ZDB-GENE-980526-375
Ensembl: ENSDARG00000034541
Vega: OTTDARG00000021104
UniProt: Q58EQ1
LinkDB
Position
16
AA seq 556 aa
MERYQLSVLCWWTFLISTVVDWRGVDGNNPFYRPYRIPQLCKFCDVLESNCNGKDTCESN
CSITSICESPDEICVAIWRQSDDNNTIETLCHNPTVPLYGIMVENNNNTKCEMKKRISNS
GPFHICSCNEVECNDMLLFKLPTNNQVVLVILVSLLPLLVLAVLVIASFYWYRLYRRRKL
DEWETKKPSKHKGPKGALDCSDACAIMMDDDRSDSSSTHANNINHNMDPLPIELDLQVGK
GRFAEVYKAKLRQSPSEQFETVAVKIFPYEEYASWKNEKDIFQDIDLKHENILHFLTAEE
RKVEKQYWLITAFHPRGNLQEYLMRHLLSWEDLRLLGSSLASGVAHLHSDHTPCGRPKVP
IVHRDLKSSNILVKNDLTCCLCDFGLGLRLDNSLSVDELANSGQVGTARYMAPEVLESRI
NLENIESFKQTDVYSMALVLWEITSRCNAIGEVKDYEPPFGSKVREHPCVESMKDNVLRD
RGRPEIPSSWMKHQGVAAVCATINECWDHDPEARLTAQCVAERFNEMDDDLDKLSTCSSS
EEKIPEDCAVSVSDDK
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggagcgatatcagctttctgtgctctgctggtggacttttttgatttctacagttgtg
gattggcgcggagtcgatggaaataatcctttttaccgtccctatcggattcctcaacta
tgtaaattctgtgatgtgttggaaagcaactgcaatggcaaagacacctgtgaaagcaac
tgctccatcacgtccatctgtgagagtccagatgagatctgtgtggctatctggaggcag
agtgatgacaacaacacaatcgagacgttgtgccacaaccccaccgtgcccctctacggc
atcatggtggagaacaacaacaacaccaagtgcgaaatgaaaaagaggatttcaaacagc
ggccctttccatatctgctcctgcaacgaggtagagtgcaacgacatgctgctattcaaa
cttcccaccaataaccaggtggtgttggtgatcctggtcagtcttctgcctctgctggtt
ctggctgtgctggtcatcgcctccttctactggtatcgcctgtaccgccgcagaaaactc
gacgagtgggagaccaagaagccttctaaacacaagggtcccaaaggcgctctggactgc
agtgacgcctgcgccatcatgatggatgatgaccgctcagacagcagctccacacatgcc
aacaacatcaatcacaacatggatccgctgcccatcgagctcgacctgcaggtgggcaag
ggccgcttcgctgaggtgtacaaagccaagctgagacaaagcccttcagagcagttcgag
acagtagcagtaaagatcttcccctatgaagagtacgcgtcctggaagaacgagaaggac
atctttcaggacatcgacctgaagcatgagaacatcctgcacttcctaacagcagaggag
cgcaaggtggagaaacagtactggctgatcacagcgtttcacccacgggggaacctgcag
gagtacttgatgcgccacttgctcagctgggaagacctgcggctgcttggcagttccctg
gcaagtggcgtggctcatttgcatagtgaccacacaccctgtgggagacccaaagtgccc
atcgtccatcgggacctcaagagttccaacatcctggtgaagaatgacctgacatgttgt
ctctgtgacttcgggctcgggcttcgtttggacaactcgctgtcggtggatgaactggct
aacagtggacaggtgggtacagcccggtacatggctccagaggtgctggaatcgaggatc
aaccttgaaaacatcgagtccttcaagcaaaccgatgtctactctatggctctagtgctg
tgggaaatcacgtccagatgtaacgccatcggagaggttaaagactatgaacctccattt
ggctctaaagtccgagagcacccctgtgtggagagcatgaaagacaatgtgctgcgagac
cgaggcaggccagagatccccagcagctggatgaaacaccagggagtggcagcagtttgt
gcaaccatcaatgaatgctgggatcacgaccctgaagcccggctgactgcacagtgtgtg
gctgaacgcttcaacgagatggacgacgacctggacaaactgtccacctgcagcagctct
gaggaaaagattcccgaagactgtgccgtgagcgtgagcgacgacaaatga

DBGET integrated database retrieval system