KEGG   Danio rerio (zebrafish): 30767
Entry
30767             CDS       T01004                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04068  FoxO signaling pathway
dre04217  Necroptosis
dre04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    30767 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    30767 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    30767 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    30767 (stat3)
Transcription factors [BR:dre03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    30767 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Spectrin
Other DBs
NCBI-GeneID: 30767
NCBI-ProteinID: NP_571554
ZFIN: ZDB-GENE-980526-68
Ensembl: ENSDARG00000022712
Vega: OTTDARG00000033676
UniProt: O93599
LinkDB
Position
3
AA seq 806 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
TAQQDGQVAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
AGELSQDLNGNSQAAATRQKMSQLEQMLSALDQLRRQIVTEMAGLLSAMDFVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIRKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDINGKTQIQSVEPYTKQQLNSMSFAEIIMGYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRPEAHPDTEFPDTGCVTQPYLKTKFICVTPCP
SVFMDFPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAAEANPGPLESLTLDMEL
SSDHASPMREGFAASTVSDMDTCRNA
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggcccagtggaatcagttgcagcagttggagacgcggtatctggagcagctgtatcac
ctgtacagcgacagcttccccatggagctccgacagttcttggccccctggatcgagagc
caggactgggcgtatgcggccaacaaggagtctcacgccacgctggtcttccacaacctg
ctgggcgagatcgatcagcagtacagccgcttcctgcaggagaacaacgtcctgtaccag
cacaacctgcggcgcatcaagcagcacctgcagagcaagtatctggagaagcccatggag
atcgcccgcatcgtggcccgctgcctgtgggaagagcagcgtctrctgcagacggccacc
actgcacagcaggatggccaggttgcccatcccactggcactgtggtgacagaaaaacag
cagatactggaacacaacctgcaggacatcaggaagagagtacaggacatggagcagaag
atgaagatgttggagaatctgcaggatgattttgatttcaactacaaaactcttaagagt
gctggagagctgtcccaggacctgaatggaaacagccaggcagcagccaccagacagaag
atgtctcagctggagcagatgctgagcgctctagatcagctcaggaggcaaatagtcact
gagatggcaggcctgctgtctgccatggactttgtgcagaagaatctgactgatgaagag
ctggccgactggaagaggagacagcagatcgcttgcatcggtgggccaccaaacatctgc
ctggaccgcttggagacatggattacttctttggctgagtcacagctgcagataagacag
cagatcagaaaactggaggagcttcagcagaaggtctcgtataaaggggaccccattatt
cagcaccgtccagctctggaggagaagatcgtagatcttttccgcaaccttatgaaaagt
gcatttgttgtggagaggcagccttgcatgcctatgcaccctgaccgaccccttgtcatc
aaaacaggagttcagtttaccaccaaagtcaggttacttgtgaaattcccagagttgaat
taccagctcaaaatcaaagtgtgtattgacaaggagtcaggtgacgtggcagccattcga
ggttcacgcaagttcaacatccttggcactaacactaaggtgatgaacatggaggaatcc
aacaatggcagcctgtcagcagagttcaaacatctgactctacgagagcagagatgtggc
aatggaggccgaaccaatagtgatgcctctctgatagtgaccgaagagttgcatctgatc
acattcgagacagaagtctaccaccaaggacttaagatcgaccttgagacgcactctctc
ccggtggtggtcatctctaatatctgtcaaatgccaaacgcatgggcctccatcctgtgg
tacaacatgctgaccaaccatcccaagaacgtgaatttcttcaccaaacctcctgtagga
acatgggatcaggtggcggaggtgctcagctggcagttctcgtccacaaccaaaagagga
cttactattgagcagctcaccacacttgcagagaaacttctgggtccctgtgtaaactac
tccggttgccagatcacatgggctaagttctgcaaagaaaacatggcaggaaaaggttty
tcattctgggtgtggctggacaacattattgacctggtgaagaaatatattttggcccta
tggaatgaagggtatattatgggtttcatcagtaaagaaagagagagagcaatcctgagt
ccaaagcctcctgggacgttcctgctgcgcttcagtgaaagcagcaaagagggaggaatc
acattcacgtgggtcgagaaggacatcaatggtaagacccagattcagtcggttgaaccg
tacactaagcagcagctcaacagcatgtcttttgctgagatcatcatgggctacaagatc
atggatgccaccaacatcctagtgtcgccgctggtctacctgtaccccgacattcccaaa
gaggaggcgtttggcaaatactgccgccctgaggcccatccagacactgagttccctgac
acaggatgtgtaactcaaccctacctgaagaccaagttcatctgtgtcaccccgtgtcct
tctgtcttcatggacttcccggacagtgagctgcttgggaacggcttccctgggactaac
tctggcaacacaagcgatttgttcccaatgtcgcctcgcacgctcgactctctcatgcac
aacgaagccgctgaggccaatccaggacctctcgaatccctcactctggacatggagttg
agctctgatcatgcgtcacccatgagagaagggtttgcagcctccacagtctcggatatg
gacacctgccgaaatgcttag

DBGET integrated database retrieval system