KEGG   Danio rerio (zebrafish): 323856Help
Entry
323856            CDS       T01004                                 

Gene name
tgm2b
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     323856 (tgm2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core ASH
Motif
Other DBs
NCBI-GeneID: 323856
NCBI-ProteinID: NP_997821
ZFIN: ZDB-GENE-030131-2576
Ensembl: ENSDARG00000074094
UniProt: Q1ECX3
LinkDB All DBs
Position
6
AA seq 679 aa AA seqDB search
MALDIGSWDLACKFNNTDHHTELNGTDRLIVRRGQAFTINLQLNSGSYQPGYSQINITAE
TGPDPQQQYGTRAVFSLSSEVDSSCWSAAVSSPPGESVCLSICAAPDAPIGHYTLTLDER
IQIQFILLFNPWCPLDVVYMDNEEKLAEYVLAQDGIIFRGDAGYPVPLAWNFGQFEEGIL
DACFRILDMNPKHRRNPAKDCSGRRNVIYVTRVLSAMINSNDQDSGVLEGCWRDTFDGGV
SPMSWGGSVQILRTWDRSSCLPVRYGQCWVFAAVACTVARAVGIPCRVVTNYYSAHDTNS
NLLIERYVNEKGEVDHSSTRDMIWNYHCWVESWMGRSDLPPGFDGWQASDPTPQEKSEGV
FCCGPVPVRAIKEGELTFKYDAPFVFAEVNADLVYFLKSKDGSTRKINYDQKVGQKISTK
SVGRDEREDITHLYKYPEGSADERRVFEKANHQNKLLQEKQNTGLNITIKLSSGVRKGCD
FDVFAIVTNGTAEEKKCRLVFASRAVSYNGVIGRECGFKDLLNVELPPGGERKVPLRLNY
SKYCNNLTEDNLIRLGALLIDYSTRDAIMAMRDIVLDDPEIKIRILGEPKENRKLAAELT
IQNPLPEALQSCCFTIEGANLTGGDSITHTLDSSIEPGQEAKAKIYFTPTQSGLRKLLVD
FNSDKLGHVRGYRNVIIGK
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggctctggacatcggctcatgggatctggcgtgtaaatttaataacacggaccaccac
acggagctgaacggcacagaccggctcatcgtgaggagaggacaggccttcaccatcaac
ctgcagctcaactccggctcataccagcccggatacagtcagatcaacatcactgcagag
actggtcctgatccgcagcagcaatacggcaccagagccgtgttcagcctgagctcagag
gtggacagttcatgttggagcgccgccgtctccagtccaccaggagaatccgtctgtctg
tccatctgcgccgctccggatgctccaatcggacactacacgctgactctagacgagcgg
atccagatccaattcattctgctcttcaatccctggtgtccacttgatgtggtgtacatg
gacaatgaggagaagctggcggagtatgttttggctcaggatggcatcatcttcaggggc
gatgccggataccccgtcccgctggcctggaactttggacagtttgaggagggaatcctg
gacgcgtgtttcaggatcctcgacatgaacccaaaacacagaagaaaccctgccaaagac
tgttctggacgcagaaacgtcatttatgtcaccagagtgctgagtgctatgatcaacagt
aatgaccaggattcaggggtcctggagggctgctggagggacacatttgacggcggcgtg
agccccatgtcctggggaggaagcgttcagatactaaggacgtgggacaggagctcgtgt
ctgccagtgcggtatggccagtgctgggtgtttgcagccgtcgcctgcacagtggctcgt
gctgtcgggatcccgtgcagagttgtaacaaactattattcagcccacgacaccaacagc
aacctgctgatcgagcgctacgtcaacgagaaaggagaagttgaccacagcagcaccaga
gacatgatatggaactatcactgttgggtcgagagctggatgggtcgttccgatctcccg
ccgggtttcgatggctggcaggcaagtgatccaacgccgcaggagaaaagtgaaggtgtg
ttctgctgcgggccggttcctgtacgggccataaaagaaggagagctcacctttaaatac
gacgccccgttcgtgttcgcggaggtgaacgcagatttagtgtacttcctcaagtctaaa
gacgggagcacaagaaagatcaactatgaccagaaagtgggccagaagatcagcaccaag
agcgtcggccgagacgagagagaagacatcacacacctctacaaataccctgaaggctca
gcggatgagaggcgagtgtttgagaaagccaatcatcagaataagctgctccaggagaag
caaaacacgggtctgaacatcaccatcaaactgtccagcggcgtcaggaagggctgcgac
tttgacgtgttcgccatcgtgaccaacggcacagcggaggagaagaagtgtcgtctggtg
ttcgcgtcccgagcggtgtcgtataacggagtgatcggcagagagtgcggctttaaagac
ttgctcaatgtggagctgccgcctggaggagagaggaaggttcctctgaggctgaactac
agtaaatactgcaataacctaacagaagataacctcatccgtctcggggctctgctgatc
gactacagcaccagagacgccatcatggccatgcgggacatcgtgctggacgaccctgag
atcaagatcaggattctgggagaacccaaggagaaccgtaagctggcggcggagctcact
atccagaacccactgcctgaagccttacagagctgctgcttcactatagagggagcaaac
ctgaccggtggagacagcatcacacacacactggattccagcattgaaccggggcaggag
gccaaagccaaaatctacttcactcccactcagtctggcctgcgcaaactcctcgtggac
ttcaacagcgacaagctgggccacgttcgaggatacaggaacgtcatcatcgggaaatga

DBGET integrated database retrieval system