KEGG   Danio rerio (zebrafish): 324052Help
Entry
324052            CDS       T01004                                 

Gene name
c1galt1c1
Definition
(RefSeq) C1GALT1-specific chaperone 1
  KO
K09653  C1GALT1-specific chaperone 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    324052 (c1galt1c1)
   00514 Other types of O-glycan biosynthesis
    324052 (c1galt1c1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    324052 (c1galt1c1)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 3 chain
   324052 (c1galt1c1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 324052
NCBI-ProteinID: NP_955961
ZFIN: ZDB-GENE-030131-2772
Ensembl: ENSDARG00000036335
Vega: OTTDARG00000021195
UniProt: E7FBK8
LinkDB All DBs
Position
14
AA seq 317 aa AA seqDB search
MMSEGSSFMKGMIFGGIFCLIMSFFETFNPGTHSEGHNHLHHHLKPVSKDELQKLSESQM
SEFAMQVRVYCLIMVTPKLLVHWATANDTWSKHCDKSVFYTSEASKALDAVDLQEQDEWT
RLRKAIQHAYENAGDLHWFFIARPTTFAIIENLKYLVLDKDPSQPFYIGHTEKSGELDYV
EYDSGIVLSYEAMRRLMEVFKDEDKCPERGRALWKMSEEKQLATCLKYSGVFAENGEDAQ
GKGLFNKKSVSSLISDSISQNPGDVVEACCSDMAITFAGMSPSQIQVLMYGVYRLRPYGH
DFHDSLTFLPPKDSDND
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgagggcagttcatttatgaaaggcatgatcttcggaggaatattctgcttg
atcatgtctttctttgagacctttaatccaggaacccactcagaaggtcacaatcacctc
caccatcatttgaaacctgtcagcaaagatgagctacagaagttatcagagtctcagatg
tctgagttcgctatgcaggttcgagtctactgcctcatcatggttactccaaagctttta
gttcactgggcgacagctaacgacacctggagcaaacactgcgacaaatctgtgttttac
acctctgaggcgtctaaagctctagatgcggttgacctacaggagcaggacgagtggaca
aggcttcgcaaagccatccaacacgcttatgagaacgccggagacctgcactggtttttc
atagcgcgacccaccacctttgctattatagagaatctcaaatacctggtgttggataaa
gatccaagccagccgttttacattggccacacggaaaagtctggagagctggattatgtg
gagtacgacagtgggattgtgttgagttatgaagcgatgaggaggctgatggaggtgttt
aaagatgaagataaatgtccagagcgaggacgagctctatggaagatgtctgaagaaaag
caactggccacttgtctgaagtacagcggagtgtttgctgaaaacggagaggacgcccaa
ggcaaagggctttttaacaagaagagtgtgagctctttgatttcggatagcatcagccaa
aatccgggcgatgtggtggaggcctgttgttctgacatggctatcacatttgctgggatg
tcgccgagtcagatacaggtcttgatgtacggcgtctacagacttcgaccgtacggacac
gactttcacgattccttgacatttctgcctccgaaagactctgataatgattga

KEGG   Danio rerio (zebrafish): 337131Help
Entry
337131            CDS       T01004                                 

Gene name
c1galt1b
Definition
(RefSeq) glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    337131 (c1galt1b)
   00514 Other types of O-glycan biosynthesis
    337131 (c1galt1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    337131 (c1galt1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     337131 (c1galt1b)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 3 chain
   337131 (c1galt1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 337131
NCBI-ProteinID: NP_956345
ZFIN: ZDB-GENE-030131-9075
Ensembl: ENSDARG00000055561
Vega: OTTDARG00000019887
UniProt: Q7SYI5
LinkDB All DBs
Position
6
AA seq 374 aa AA seqDB search
MKALGARSAFYVGFLVGTCSLYLLLRQAGFTRDSGSREPGTHDKTLLEMLEEENKNWKKE
RSALFNLNHPHHTGEDGALADSLYKRVRILCWVMTGPDNLEKKARHVKATWSRHCNIVVF
ISSVDNPDFPTVGLNTKEGRDQLYWKTIRAFHYVMEKHSDEADWFLKADDDTYVIVDNLR
WILARHSPEDPVYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVEGFRTKVCTHTTSVED
LAMGQCMEKIGVKAGDSRDTMQRETFHPFVPESHLTGTFPKTFWYWNYCYYPIVQGPQCC
SDLAVSFHYVDASHMYLLEYYTYHLRAFGYKYRYQPPEPNVKAPEKVETRVLEQKDKVEA
QEEENQSPELNDKL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcggcgcgcgctccgcgttctacgtgggctttctggtgggcacgtgcagc
ttatacctgctcctgcgtcaggctgggttcacccgggactcgggctctcgtgagcccggg
acccacgataaaaccctgctggaaatgcttgaagaagaaaacaagaactggaagaaggag
aggtcggctcttttcaacctcaatcatccgcaccatacaggtgaggatggcgcactggct
gactctctttataagcgtgtacgcattctctgttgggttatgactggccctgataacctg
gaaaagaaagctcggcatgtgaaagccacatggagtcgtcactgcaacattgtggtcttt
ataagctctgtggacaatccagattttcccacagttggcctgaacactaaagaaggtcgg
gatcagctatactggaaaaccatccgcgctttccactatgtcatggagaagcacagcgat
gaggcagactggtttctcaaagcagatgatgacacttatgtgatcgttgacaacctgcgc
tggattctggctcgccattctccagaggacccagtgtactttggccggcgttttaagcca
tatgtaaaacagggctacatgagtggaggtgctggctatgtgctcagcaaagaggctctg
aggaggtttgtggagggctttcgcaccaaggtgtgcactcacactacctcagtggaggac
cttgctatgggtcagtgtatggagaagataggtgtcaaggcaggagactccagagacacc
atgcaaagagagacattccatcctttcgtacccgagtcccatctcactggcacatttccc
aaaactttctggtactggaactactgttattaccccattgtacagggcccacagtgttgc
tcagacctggctgtttctttccactatgtggatgcgtcgcacatgtacctgctggaatac
tacacttaccacttgcgtgcctttggctacaaatatcgctatcagccccctgaacccaat
gttaaagccccagagaaagtagaaactcgagtcttggagcaaaaggacaaggttgaagca
caggaagaggaaaaccaatcccctgaacttaacgacaagttatag

KEGG   Danio rerio (zebrafish): 555344Help
Entry
555344            CDS       T01004                                 

Gene name
si:dkey-202e17.1
Definition
(RefSeq) uncharacterized protein LOC555344
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    555344 (si:dkey-202e17.1)
   00514 Other types of O-glycan biosynthesis
    555344 (si:dkey-202e17.1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    555344 (si:dkey-202e17.1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     555344 (si:dkey-202e17.1)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 3 chain
   555344 (si:dkey-202e17.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 555344
NCBI-ProteinID: NP_001121803
ZFIN: ZDB-GENE-060503-810
Ensembl: ENSDARG00000062278
Vega: OTTDARG00000014704
UniProt: A3KQK4
LinkDB All DBs
Position
19
AA seq 247 aa AA seqDB search
MTQPQNLQSRTQHVHATWGKRCDTILYMTSKNTDFPTIGLNVSEGRNQLYWKTIRAFQYI
HKHHLDDADWFLKADDDTFVVIENLRHSLSKHSSEDPLYFGRRFRPFVAQGYMSGGAGYV
LSKEALRRFVKGFADGLCTHTTELEDVGMGQCMEKMKVEMGDSRDVFGRQVFHPYPPGNY
LVRQLRRQRPWYLIYDHYTPVEGPGCCSDFAISFHYINAVEMHTLEYYTYHLRPYGYKYR
FNPDELK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcctcaaaacctgcagtccagaacccaacacgttcatgccacatggggcaaa
cgctgcgacaccatcttgtacatgacctcgaagaacacggacttccccacgatagggctc
aatgtgtcagaaggacgcaatcaactctactggaagaccatacgagccttccagtacatt
cacaagcaccatttggatgatgctgattggttcctcaaagctgacgatgacacatttgtt
gtcattgagaatttgcgccatagcttgtccaaacacagctcagaggatcctctgtatttt
ggacgtcgcttcaggccctttgttgcacaaggctacatgagtggaggggccggttacgtc
ctcagtaaagaagctttgagaagatttgtgaaggggtttgctgatggactttgtacgcac
accacagaacttgaggatgttggaatgggacaatgcatggagaaaatgaaagttgagatg
ggggattccagggatgtgtttgggagacaagtctttcacccttaccctccaggcaattac
ttggtgagacagctacgcagacaacgaccctggtacctcatctatgatcattatactcca
gttgagggtccgggatgctgctcagattttgccatctcattccattacataaacgcagtg
gaaatgcacacattggagtactacacatatcatttacgcccgtatggatacaaatacaga
ttcaatccagatgaactgaaatga

KEGG   Danio rerio (zebrafish): 557675Help
Entry
557675            CDS       T01004                                 

Gene name
c1galt1a
Definition
(RefSeq) glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    557675 (c1galt1a)
   00514 Other types of O-glycan biosynthesis
    557675 (c1galt1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    557675 (c1galt1a)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     557675 (c1galt1a)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 3 chain
   557675 (c1galt1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 557675
NCBI-ProteinID: NP_001070842
ZFIN: ZDB-GENE-061013-303
Ensembl: ENSDARG00000055585
Vega: OTTDARG00000028603
UniProt: Q08BL3 B2GPW7
LinkDB All DBs
Position
23
AA seq 408 aa AA seqDB search
MVIMKAGSSRCAFSLGFLVGSCSLYVFLRQVWFEESFSWQSNGRSSPSPPISHEQNSSNL
TWRVEGSALINLKHPNQPGEDGHIADELFKKVRILCWVMTGPSNLQSKAQHVKNTWSRHC
NVVLFMSSEEDRSFPTVGLGTGEGRDQLYWKTIRAFHYALKNHGHEADWFLKADDDTFVV
VDNLRWILSNYTPEQPIYFGKRFKPYTKQGYMSGGAGYVLSKEALRRFVEGFSTKVCTHT
TPVEDLAMGQCLEKMGVLAGDSRDSLHRETFHPFIPEHHLTGKFSKTFWYWNYCYYPIVE
GPQCCSDLAVSFHYVDPVLMYTLEYYTYHLRPFGYQHRYQPPVPAVLSLLSQTVKTTTET
QRSEEGAKEKPALTNSVNPRAEEVQTTETSYKITNAAQERNTTHRSAG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcatgaaagcaggcagttcaaggtgcgccttctccctgggtttcctggtgggc
agctgtagtttgtacgtcttcctgaggcaggtttggtttgaggagagcttcagctggcag
agcaatggcaggagcagcccgtctccaccaataagccacgagcaaaactcctccaacctt
acctggagagttgaaggatctgccctgatcaacctcaagcatcctaaccagccaggagag
gacggtcacatagccgatgagctgttcaagaaagtgcgaatcctgtgctgggtgatgacc
ggacccagtaacctccagtcaaaagctcagcacgtgaagaacacatggagtcgccactgt
aacgtagtgctatttatgagctcagaagaagaccgcagtttccccacggttggcctcggc
actggtgaaggccgagaccaactgtactggaagaccatccgtgccttccactacgcccta
aagaaccacggccatgaggcagactggttcctcaaagcagacgatgatacttttgttgtt
gtggacaatttgcgatggatcctgtcgaactacacaccggagcagcctatatattttggc
aagcgatttaagccgtacaccaagcagggctacatgagcggtggcgcagggtatgtgctc
agtaaagaagctctaagaaggtttgtggaggggtttagcactaaagtgtgcactcatact
acaccggtggaggatctggcgatggggcagtgtctggagaaaatgggggtcctggctgga
gactcgagggactcgctgcacagagaaacctttcatccttttattcccgagcatcatctt
actggaaagttctccaagaccttctggtactggaattattgctattacccaattgtagaa
ggccctcagtgctgctctgatctggcagtttctttccactacgtagatcctgtgctcatg
tacacccttgaatactacacttaccatctgaggccgtttggctaccagcaccgctaccag
cctccagtgcctgctgtcctgtcattactgtcccaaactgtgaaaaccaccacagaaact
cagagatcggaggagggcgctaaagaaaaaccagctttaacaaactcagtgaatcccaga
gctgaagaagtacagacaactgaaacaagttacaaaatcacaaatgctgcccaggagaga
aacacaacccacagaagtgcagggtga

DBGET integrated database retrieval system