KEGG   Danio rerio (zebrafish): 324254
Entry
324254            CDS       T01004                                 

Gene name
mtor
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04136  Autophagy - other
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04218  Cellular senescence
dre04371  Apelin signaling pathway
dre04910  Insulin signaling pathway
dre04920  Adipocytokine signaling pathway
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    324254 (mtor)
   04371 Apelin signaling pathway
    324254 (mtor)
   04150 mTOR signaling pathway
    324254 (mtor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    324254 (mtor)
   04136 Autophagy - other
    324254 (mtor)
  09143 Cell growth and death
   04218 Cellular senescence
    324254 (mtor)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    324254 (mtor)
   04920 Adipocytokine signaling pathway
    324254 (mtor)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    324254 (mtor)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    324254 (mtor)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    324254 (mtor)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     324254 (mtor)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   324254 (mtor)
Membrane trafficking [BR:dre04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    324254 (mtor)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 IFRD HEAT EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 324254
NCBI-ProteinID: NP_001070679
ZFIN: ZDB-GENE-030131-2974
Ensembl: ENSDARG00000053196
Vega: OTTDARG00000026928
UniProt: Q06RG6
LinkDB
Position
8
AA seq 2515 aa
MSGTATVLQQFVSGLKSRNEDTRAKAAKDLQHYVTTELRELSQDEATTFYDELNHHIFEL
VSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSSDSVVMEMASKAMGHLS
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSAPTFFFQQVQPFFDNI
FYAVWDSKQAIREGAVSALRACLILTTQRETKEMQKPQWYKQTFEEAEKGFDETLAKEKG
MNKDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDKYCKELMGFSTKPRHIT
PFTSFQSVQPQQSNALLGLLGYSTPQGFLSFGAAPVPSKSTLVESRYCRELMEERFDQVC
RWVLKYRTSKNPLIQMTILNLLPRLAAFQPHTFTDQYLQDTMGHLLGCLKKEKERTAAFQ
ALGLLVVAVRADIQPYLSKILEIIKAALPPKDFAHKRQKTMQVDATVFTCISMLSRAMGP
SIQQDVKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHP
GMPKGLAYQLSSPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEH
KEIRMEAARTCSRLLTPSIHLLSGHGHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCV
LASLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIGRLSSMNPAFVMPFWPKMLI
QILTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPNPGVVIC
VLATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQVALWTLGQQVASTGYVVEP
YRKYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSL
SESKSSQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRILRDPSLSNHHTMVVQAVTF
IFKSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGMVVCFVKIHIRPYMDDIFTL
IREYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDMSVGRNVTIKLL
MAIQLFGANLDDYLHLLLPPVVKLFDAPDVPLQARKVALETLDRLTESLDFTDYASRIIH
PIVRTLDVTPELRNSSMDTLSSLVFQLGKKYQIFIPMVNKVMLKHRINHQRYDVLICRIV
KGYTLAEEEEDPLIFQHRQLRSSQSDTLVSGPVESGPMKKLHVSTTALQKAWGAARKVSK
DDWLEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLFNAAFLSCWSELSEDQQDEL
IRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKAL
HYKELEFQKGASPLILESLISINNKLQQPEAASGVLEYAMKHFGELEIQATWYEKLHEWE
DALVAYDKKIDMNKDDPELILGRMRCLEALGEWGQLHQQCCEEWTLVSEETQAKMARMAA
AAAWGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTA
MAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERRDIIRETWWERLQGCQRIVEDWQRIL
MVRSLVINPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSKQLDHPLPTAHPHVT
YAYMKYMWKSTRKIDAFQHMQHFVQGMQQQAQHAIAAEDQQHKLELHKLMARCFLKLGEW
QLSLQGINESTIPKVLQYYSHSTEHDRNWYKAWHAWAVMNFEAVLHYKHQNQGRDEKKKL
RHASGASANSEASNSDSEADSTEHSPVPSPGQKKVNEDLSKTLLLYTVPAVQGFFRSISL
SRGNNLQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTWLQVIPQLIARIDTPRALVG
RLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHCNTLVQQAIMVSE
ELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLHAMMERGPQTLKETSFNQAY
GRDLMEAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCR
DLELAVPGTYDPNQSIIRIQSIAPSLQVITSKQRPRKLTIMGSNGHEFMFLLKGHEDLRQ
DERVMQLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYR
EKKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWF
DRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEK
IPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLMDT
NTKGNKRSRTRTDSYTAGQSVEAMEGIDLGETTHKKPGTTVPESIHSFIGDGLVQPEALN
KKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7548 nt   +upstreamnt  +downstreamnt
atgtctggcactgccacagttctgcagcagtttgtgagtggcctgaagagtcgcaatgaa
gacactcgtgccaaagctgccaaagaccttcagcactacgtcacgacagaactaagagag
ctgagccaagatgaagccaccactttctacgatgaactgaaccaccacatttttgagttg
gtttccagctcagatgtgaatgagaaaaaaggcggtatccttgccatagtgagcctgatt
ggagtggagggaggaaatgccacccgtatcagccgctttgccaactatttgcggaacctg
cttccgtccagtgactcagtggtcatggagatggcctctaaagccatgggtcacctgtcc
atggcgggagacaccttcactgcagagtatgtggagtttgaggtgaagagagctctggag
tggctgggagcagacaggaatgaaggcagacgacatgcagcggtgctggtgttacgagaa
ctggctgtcagcgcacctacattctttttccagcaggtgcagccattctttgataacatt
ttttatgcagtgtgggactccaaacaggccattcgtgagggcgcagtatctgctctcaga
gcttgtttgatccttaccactcagagagagaccaaagagatgcagaaaccacagtggtac
aagcaaacatttgaggaagccgagaagggttttgatgagactttggcgaaagagaaaggg
atgaataaggatgatcgtgtacatggagctctactgattctcaatgagctagtgcgaata
agcagtatggagggagagcgtatgagagaggagatggaggagatcacgcagcagcagttg
gttcatgataagtactgtaaggagttgatgggtttcagcactaagcctcgtcacatcacg
cccttcaccagttttcagtccgttcagccgcagcagtctaacgctctgctggggctgctg
ggttacagcacacctcagggcttcttaagttttggagctgcacctgttccctcgaaaagc
acactggtggagagccgctactgcagagaactgatggaggagcgctttgaccaggtgtgc
cgttgggtgctgaaatacaggaccagtaagaatcctctaatccagatgacaatcttaaac
ctactgcctcgacttgctgccttccagcctcacactttcactgatcagtatttgcaggac
actatggggcacctgctgggctgcctaaaaaaagaaaaggagcggacggcagcatttcaa
gcgctggggctactggtggtggctgtgagggctgatattcagccatacctaagcaagatc
ctggagattatcaaagctgcattgccaccgaaagactttgcgcacaagaggcagaagacc
atgcaggtggatgctactgtatttacttgcataagtatgctgtccagagctatggggcct
agcatccaacaggacgtcaaagaacttctggagcccatgctagctgttggtctcagccct
gctttgactgcagtgctttacgacctgagcaggcagatcccacagctgaagaaggacatt
caggatggtctgctaaagatgctttcacttgtgctcatgcacaagcctcttcgtcacccg
ggtatgcccaagggcctggcgtatcagctgtcatcgcccagcctgaccaacatccctgag
gctagcgacgtgggcagcataactctggcactgagaactctcggcagctttgaatttgaa
ggccactccttgacccagtttgtgcgtcactgtgcggaccactttttgaacagcgagcac
aaggagatccgcatggaggcggcgcgcacctgctcacgtctgcttaccccctccatccac
ctgctcagcggacatggacacgtggtcagtcagactgctgtgcaggtggtggctgacgtt
ctcagcaagctacttgtggttggcatcactgacccagaccctgatattcgatactgtgtg
ctggcctccctggacgaacgctttgatgcccacctggcacaagcagagaacctccaggct
ctgtttgtggcgctgaatgatgaagtgtttgagatccgcgaactggccatctgcaccatc
ggtcgactcagcagtatgaaccctgcctttgtcatgcccttctggcccaagatgctcatt
cagattctgactgagctggaacatagcggtgtgggccgaaacaaagagcagagtgcccgc
atgctgggtcacttggtttccaatgctcccagacttattcgcccatacatggagcccatt
ctcaaggccctcattttaaagctgaaagatcccgatccaaaccctggagttgtcatctgt
gttttagctactattggagaacttgcccaggtgagtggactggagatgaggaaatggatg
gatgagctgttcccaatcattatggacatgctgcaggactcatcttcattagccaagaga
caggtggcactttggactctgggccaacaagtagccagcactgggtatgtggtggagcct
tacaggaagtatccatctctactggaggtgctgctcaacttcctgaagacagaacaaaac
caggggatcaggagagaggccattcgtgttctaggtctgctaggagctctggatccctac
aaacacaaagtgaacatcggaatgatcgaccagtctcgagatgcttctgccgtcagcctc
tccgagtccaagtccagccaggattcagctgactacagcaccagcgagatgctggtcaac
atgggcaacctgccgctagacgagttttacccagcagtcgccatagtgaccctgatgcgt
atcctgcgtgacccgtcgctgtccaatcaccacaccatggtcgttcaggccgtgaccttc
attttcaaatctcttggcctcaaatgtgtgcagttcctgcctcaggtcatgcccaccttt
ctcaacgtcatcagagtgtgtgatgccagcatcagagagtttcttttccagcaaatgggg
atggttgtgtgcttcgtcaaaatccacatccggccctacatggatgatatcttcacacta
atccgggaatactggactccaaacaaccctatgcagaacaccatcattttgctgattgag
cagattgttgtggctctcggtggagaattcaaactctaccttccacagctcatcccacac
atgctgcgagtcttcatgcacgacatgagtgttggacgcaatgtcaccatcaagttactc
atggccatccaactgttcggagctaacctggatgactatctccacctgctgctgcctcct
gtagtgaaactgttcgatgccccggatgtccctctgcaagcccgcaaggttgctttggag
actttagatcgcctgactgaatcgttggacttcacggattatgcctccagaattatccac
cccattgttcgcactcttgatgttactccagagctgaggaactcctccatggacacactg
tcctcgctggtcttccagcttggtaaaaagtatcagatcttcattcctatggtgaacaaa
gtgatgttgaaacaccgcatcaatcaccagcgctatgatgttctcatctgtcgtatcgtc
aagggatatactttggccgaagaggaagaggaccctttaatatttcagcacagacaattg
cgtagtagtcaaagcgacacactggtcagtggcccagtggaatctggacctatgaagaag
ctgcacgtcagcacaactgctcttcagaaggcatggggtgcagccagaaaggtgtccaaa
gatgactggctggagtggttgagaagacttagtgtggtcttgctaaaggaatcctcctca
ccagccctgcgctcctgctggtctctagcacagacatatataccactggctagggatctt
ttcaatgctgcattcttatcgtgctggtccgagctgagtgaagaccagcaggatgagctg
atccgcagtattgagcttgctctgacatctcaggatattgctgaggtcacacagacactg
ctcaacctcgcagaattcatggagcacagcgataagggcccacttcctttgagagatgac
aatgggatagttctgctgggggagagagctgctaaatgtcgggcctacgccaaagccctg
cactacaaggagctggagtttcaaaagggggcttcaccgctcattttagaatctctgatc
agcatcaataataagctccagcagccagaggccgcatcaggagtgctggagtatgccatg
aaacactttggagaattggagatccaggccacctggtatgagaaacttcatgagtgggaa
gatgctctggttgcctacgataaaaaaatcgacatgaacaaagacgatccagagcttatt
ttgggtcgcatgagatgtctggaagcactaggcgaatggggtcagcttcaccaacagtgc
tgtgaggagtggactctggtcagtgaagaaactcaagccaagatggcccgcatggcagca
gctgcggcgtggggactgggccactgggacagtatggaagagtatacctgcatgatcccg
cgagacacccacgatggagccttttaccgggcagtgcttgctttacatcaggatctgttt
tcattggctcagcagtgtattgacaaggccagagatctgctggatgccgagctcaccgcc
atggctggagagagttacagtagagcatacggggctatggtatcatgccagatgctttcg
gagttagaggaggtgatccagtataaactggttcctgagagaagggacatcatcagggaa
acatggtgggagagactgcagggttgtcaacgcattgtggaagactggcagaggatctta
atggtgcgctctttggtcattaacccacatgaggacatgaggacgtggttgaagtacgcc
agcctctgtggaaaaagtggaagactggcgctggcccataagactctggttctcctgctg
ggtgtggatccctccaaacagctcgaccaccccttgcccaccgcccacccgcatgtcacc
tacgcttacatgaagtacatgtggaagagcactcgcaagatcgatgccttccagcatatg
cagcactttgtgcagggaatgcaacagcaagcacaacatgccatcgcagctgaagaccag
cagcacaagctggagctgcacaaactaatggcacggtgttttctgaagctgggggagtgg
cagctcagccttcagggcatcaatgagagcaccatccctaaagtcttgcagtattacagt
cactcaacggagcatgatcgcaactggtacaaggcctggcatgcttgggcagtaatgaac
tttgaggccgtgcttcactacaagcatcagaaccagggccgcgatgagaagaagaaactg
cgacacgcaagcggcgccagcgccaacagcgaagccagtaacagcgacagcgaagccgac
agcaccgagcacagtcccgtaccctcacccggacagaagaaagtcaacgaagatttgtcc
aagactctccttctttacacagtgcctgcagtgcaggggtttttcagatccatctcactc
tcacgtggaaataacttacaggacacactgagagtcctgaccttatggtttgattatggt
cactggcctgaagtgaatgaagctctagtcgaaggtatcaagaccattcagatagacact
tggttacaggtgattcctcaactgatcgctcggattgatacgccacgtgcactggtggga
cggctcattcaccagctactcactgacatcggtcgctaccaccctcaggctttgatttat
cctctcaccgtggcctccaaatccacaaccactgcccgtcacaacgcagccaacaagatc
ttgaagaacatgtgtgagcactgcaacacgctggtccagcaagctattatggtgagcgag
gagcttatcagggtcgctattctctggcatgaaatgtggcacgaggggctggaggaagcg
tcacgtctatattttggagagaggaacgtcaagggaatgtttgccgttctggagcccctc
catgccatgatggagagaggaccacaaaccctaaaagaaacatcatttaatcaggcttat
ggccgagatctgatggaggcgcaggactggtgtagaaagtacatgcgatcgggtaacgtc
aaggacctgacgcaggcgtgggatctgtactaccatgtgttccgcaggatctccaaacag
ctgccacagctcacttctctagagcttcagtacgtctcacctaaactgctgatgtgtcgt
gatttggagttggctgtgcctggaacatatgaccccaatcagtcaatcatacgcatccag
tccattgctccctcgctgcaggtcatcacctccaaacagcggccacgcaaactcaccatc
atgggcagcaatggccatgagttcatgttcctgctgaagggtcatgaagatttacgacag
gacgagagggtcatgcagctttttggcttggtgaacactctactggctaatgacccagcc
tccctgcgcaagaacctgagtattcagcgctatgctgtgatcccgctttccaccaactct
ggcctgattggctgggttcctcactgtgacacgctgcacgcactgattcgagactacaga
gagaagaagaagatcctgctcaacattgaacatcgcatcatgctcaggatggcccctgac
tatgaccatttgactctaatggagaaggtggaagtgtttgagcatgcagtgaacaatact
gcaggagatgacctggccaaactgctttggctgaagagtcccagttcagaggtctggttt
gacaggaggaccaactacacacgctcgctagctgttatgtccatggttggctatatctta
ggacttggagacaggcatccttctaatctgatgttggacaggctcagtggaaagatactg
catatcgattttggagactgttttgaggttgcaatgaccagagaaaaattcccagagaaa
attccttttagattaactcgcatgttaaccaatgccatggaggtgacgggactggatggt
aactaccgtatcacatgccacacagtgatggaggtactccgggaacacagggacagtgtc
atggctgtgctggaggcctttgtctatgacccgttactcaactggaggcttatggacaca
aacactaaaggaaataagcgatcccggaccagaactgactcctatacggcaggacagtct
gtcgaagccatggagggtattgacctgggagaaacaacgcacaaaaagcctggaactacc
gtgcctgagtccattcactctttcattggagacggccttgtgcaacctgaagccttgaac
aagaaagccattcagatcatcaaccgagtgcgggacaagttaactggtcgagatttttcc
catgatgagactctggacgtaccaacacaagtggagctgctcattaagcaagctacgtca
catgaaaacctgtgccaatgctacattggatggtgccctttttggtag

DBGET integrated database retrieval system