KEGG   Danio rerio (zebrafish): 334197Help
Entry
334197            CDS       T01004                                 

Gene name
aldh7a1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00053  Ascorbate and aldarate metabolism
dre00071  Fatty acid degradation
dre00260  Glycine, serine and threonine metabolism
dre00280  Valine, leucine and isoleucine degradation
dre00310  Lysine degradation
dre00330  Arginine and proline metabolism
dre00340  Histidine metabolism
dre00380  Tryptophan metabolism
dre00410  beta-Alanine metabolism
dre00561  Glycerolipid metabolism
dre00620  Pyruvate metabolism
dre01100  Metabolic pathways
Module
dre_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
dre_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    334197 (aldh7a1)
   00053 Ascorbate and aldarate metabolism
    334197 (aldh7a1)
   00620 Pyruvate metabolism
    334197 (aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    334197 (aldh7a1)
   00561 Glycerolipid metabolism
    334197 (aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    334197 (aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    334197 (aldh7a1)
   00310 Lysine degradation
    334197 (aldh7a1)
   00330 Arginine and proline metabolism
    334197 (aldh7a1)
   00340 Histidine metabolism
    334197 (aldh7a1)
   00380 Tryptophan metabolism
    334197 (aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    334197 (aldh7a1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     334197 (aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     334197 (aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     334197 (aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 334197
NCBI-ProteinID: NP_997889
ZFIN: ZDB-GENE-030131-6129
Ensembl: ENSDARG00000018426
Vega: OTTDARG00000019642
UniProt: Q803R9
LinkDB All DBs
Position
10
AA seq 511 aa AA seqDB search
MSTLLINQPEYNWLKELGLKEDNDGVYNGSWGGQGEVVTSYCPANNEPIARVRQATIAEY
EETIQKALDAWKVWADVPAPKRGEIVRQIGEALRRKIKALGSLMSLEMGKVYVEGVGEVQ
EYVDVCDYAVGLSRMIGGPILPSERPGHVLIEQWNPVGLVGIITAFNFPVAVYGWNNAIA
LICGNACLWKGAPTTPLTSVAVTKIVAEVLEQNHLPGAICSMTCGGADIGMAMAKDERVG
LLSFTGSTHVGKQVAMMVQERFGRQLLELGGNNAIIVFEDADLSLVVPSAVFASVGTAGQ
RCTTTRRLMLHESIHDEVVERIAKAYKQIRIGDPWDPNTLYGPLHTKQAVQQYLAAIEQA
KQQGGTLVCGGKIMDRPGNYVEPTIITGLPHNASIVHTETFVPILYVLKFKTEEEAFSWN
NEVKQGLSSSIFTKDMGRVFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRES
GSDSWKQYMRRSTCTINYSKDLPLAQGIKFE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactctgcttattaaccaaccagagtacaactggttgaaagagttagggcttaaa
gaggacaatgacggtgtttacaacggttcttggggaggacagggagaggtggtcacttca
tattgtccagcaaacaatgagccaattgccagagtgcgtcaggcaaccatagcagaatat
gaggaaaccatacagaaagcactggacgcatggaaagtgtgggcagatgtacctgctcca
aagagaggggaaattgttcgacagattggagaggctttaaggaggaagatcaaagctctc
ggcagcttgatgtctctagagatgggcaaggtctatgtggagggtgttggtgaggtgcag
gagtatgtggatgtgtgcgactatgctgtaggactgtcccgtatgattggaggtcccatt
ttgccatctgaaaggccaggtcatgtgctgatcgagcagtggaatcctgttggcttggta
ggaatcatcacagcctttaactttcctgtggctgtatatggctggaacaatgccattgct
ctcatctgtggaaatgcctgtctttggaaaggagctccgaccacaccccttacaagtgtt
gcggttaccaagattgtagctgaagtgttggagcagaatcatcttcctggtgcaatctgt
tctatgacatgtggtggcgctgacattggcatggccatggctaaagacgagcgagtgggt
cttctgtccttcacgggtagcactcatgtgggcaaacaagtggcaatgatggtacaagaa
cggtttggtcgtcagctactggagttaggaggaaataacgccatcatagtatttgaggat
gctgatcttagcttggttgtaccgtctgctgtctttgcatctgtgggaacggctggtcag
cgatgtactactaccagacgactgatgctgcatgaaagcatacatgatgaggttgtggag
agaatcgctaaagcttacaagcagattcgcattggtgacccctgggacccaaacactctt
tatggacctctgcacaccaaacaggctgttcagcagtatctggcagccatagagcaggca
aaacagcagggtgggactcttgtgtgtggaggaaagatcatggatcggccgggtaactat
gtggaacccactattatcactggactaccgcacaatgcttctatagttcacactgagacc
tttgtgcccatcctttatgtgctgaaatttaagacagaggaagaggcattttcctggaat
aacgaagttaaacaagggctctccagcagtatctttactaaagacatgggaagagtgttc
cgctggttaggtcctaaaggctccgactgtggcattgtgaacgttaacattcctactagc
ggtgctgagattggaggagcgtttggaggtgagaaacacacaggaggtgggcgcgagtcg
ggcagcgattcttggaagcagtacatgagaaggtccacatgcaccatcaactacagcaaa
gatctgcctttggcccaggggatcaagtttgaatga

DBGET integrated database retrieval system