KEGG   Danio rerio (zebrafish): 335916
Entry
335916            CDS       T01004                                 

Gene name
jun
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04137  Mitophagy - animal
dre04210  Apoptosis
dre04310  Wnt signaling pathway
dre04510  Focal adhesion
dre04530  Tight junction
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04912  GnRH signaling pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    335916 (jun)
   04012 ErbB signaling pathway
    335916 (jun)
   04310 Wnt signaling pathway
    335916 (jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    335916 (jun)
  09143 Cell growth and death
   04210 Apoptosis
    335916 (jun)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    335916 (jun)
   04530 Tight junction
    335916 (jun)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    335916 (jun)
   04621 NOD-like receptor signaling pathway
    335916 (jun)
   04625 C-type lectin receptor signaling pathway
    335916 (jun)
  09152 Endocrine system
   04912 GnRH signaling pathway
    335916 (jun)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    335916 (jun)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    335916 (jun)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    335916 (jun)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 ZapB PspA_IM30 FlaC_arch Paralemmin Jnk-SapK_ap_N Fib_alpha TEX13 DUF3450
Other DBs
NCBI-GeneID: 335916
NCBI-ProteinID: NP_956281
ZFIN: ZDB-GENE-030131-7859
Ensembl: ENSDARG00000043531
Vega: OTTDARG00000009040
UniProt: Q6NZT5
LinkDB
Position
20
AA seq 308 aa
MSTKMETTFYDDSLNSAFSQHDSATFGYNHKALKHNMTLNLSDPAGNLKPHLRAKASDIL
TSPDVGLLKLASPELERLIIQSSNGMITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAEL
HHQHMPNVTSAPQTTINSSMAPVSSIAGGAVYSSAMRADPPVYADLNTFNPAISSSSANP
AAMSFPSAPPQLPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNR
IAASKCRKRKLERISRLEDKVKTLKSQNSELASTANMLREQVAQLKQKVMNHVNSGCQLM
LTQQLQTF
NT seq 927 nt   +upstreamnt  +downstreamnt
atgtctaccaagatggaaactactttctacgatgactctctaaacagcgctttctctcag
catgacagtgccacttttggatacaaccacaaggctctgaaacacaacatgacgctcaat
ctgtccgaccccgcggggaacctgaagccccacctgagggccaaagccagcgatatcctc
acttctcccgacgtgggacttctcaaactggcatcaccggagctggagaggctcatcatc
cagtctagcaacggcatgatcaccacgacgccaactccgacccagtttctgtgtcccaag
aacgtgacggatgagcaggaggggttcgcggagggctttgtgagggcacttgctgagctg
caccaccagcacatgcccaacgtcacctcggctccccaaactactatcaacagcagcatg
gcaccggtctcgtccatagcgggcggtgcggtctacagctcagccatgcgcgctgatccg
ccggtttacgcggatctgaacacgttcaaccctgccatcagcagcagctcggccaatcca
gccgcgatgagcttcccgagcgcaccaccgcagctgcccgtccagcacccgcgcctccag
gccctgaaagaggagccccaaacggtgcccgagatgcccggcgagaccccaccgctctct
cctatcgacatggagagccaggagcggattaaagccgagaggaagcgcatgagaaacaga
atcgccgcgtccaaatgccggaagaggaaactggagaggatctcccggctggaggacaaa
gtcaagaccctgaagtcgcaaaactcggagctcgcgtccaccgccaacatgctgcgcgag
caagtggcacagctcaagcagaaagtcatgaaccacgtcaacagcggctgccagctcatg
ttgacacaacagctgcaaaccttctga

DBGET integrated database retrieval system