KEGG   Danio rerio (zebrafish): 337571Help
Entry
337571            CDS       T01004                                 

Gene name
yrk
Definition
(RefSeq) tyrosine-protein kinase Fgr isoform 1
  KO
K17511  proto-oncogene tyrosine-protein kinase YRK [EC:2.7.10.2]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    337571 (yrk)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    337571 (yrk)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     337571 (yrk)
Protein kinases [BR:dre01001]
 Non-receptor tyrosine kinases
  SRC family
   337571 (yrk)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    337571 (yrk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_3 APH
Motif
Other DBs
NCBI-GeneID: 337571
NCBI-ProteinID: NP_001352482
ZFIN: ZDB-GENE-030131-9517
Ensembl: ENSDARG00000004378
Vega: OTTDARG00000024451
LinkDB All DBs
Position
19
AA seq 528 aa AA seqDB search
MGCACCKQRKASKAVSNQNSCDAFNGTQASEPSRYIPDPTFNSGIPNFNDFSNPLTPPTS
IINPARPPGLTGGGVTLFIALYEYDARTEDDLSFQKGEKFHIINNTEGDWWEARSLDTGK
SGYIPSNYVAPVDSIQAEEWYFGKMGRKDAERQLLAQNNPRGTFLIRESETTKGAYSLSI
RDWDDAKGDHVKHYKIRKLDNGGYYITTRTQFDTVQQLVEHYTERAAGLCCRLIGSCRRG
MPKLADLSVKTKDVWEIPRESLQLIKKLGNGQFGEVWMGMWNGTTKVAVKTLKPGTMSPE
AFLDEAQIMKRLRHDKLVQLYAVVSEEPIYIITEFMSQGSLLDFLKDGDGRNLKLPQLVD
MAAQIAAGMAYIERMNYIHRDLRAANILVGDGLVCKIADFGLARLIEDNEYTARQGAKFP
IKWTAPEAALYGKFTIKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVERGYRMPCPQ
GSPASLHELMLQCWRKDPDERHTFEYLQSFLEDYFTATEPQYQPGENL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgcttgctgtaagcagaggaaggccagtaaagctgtgtcgaaccaaaactcc
tgcgacgcattcaatgggacgcaggcgtcagaaccgtcccgctacatccccgatcccaca
tttaactcaggaatcccaaacttcaatgatttctcaaacccacttactcctccaacgtcc
atcatcaacccggcacgtcctcctggactcacaggaggtggcgtgaccctctttatagcc
ctctatgaatatgatgctcgtactgaagatgatctgagcttccagaaaggagaaaagttt
catattatcaacaacaccgagggcgactggtgggaggctcgatctctagacactggcaaa
tctggatatattcccagtaactatgtggctcctgtggactccatacaggctgaggagtgg
tattttgggaagatgggccggaaagatgctgaacgacagctgctggcgcaaaacaatccc
agagggacatttttaatacgcgagagcgagacaactaaaggagcttattctttgtccatc
agagactgggacgatgcgaaaggcgatcacgtcaagcattacaagatcaggaagctggac
aacggtggatattacatcacaaccaggactcagtttgatacagtccagcagctggtggag
cattacacagagcgggcagcagggctgtgctgccgtctgattggcagctgtaggcggggc
atgcctaagctggccgacctatcagtgaagaccaaagatgtttgggagattccaagagag
tcccttcagctcattaagaaactgggcaatgggcagtttggtgaagtgtggatgggcatg
tggaacggcaccactaaagtggctgtgaaaacgctgaagcctggcaccatgtctcctgaa
gccttcctggatgaggcgcagatcatgaagaggctccgtcatgataaactggttcagctt
tatgctgtggtgtccgaggagcctatctacatcatcaccgagttcatgagtcaaggaagc
ttattggactttttgaaagatggtgatggcagaaatttaaaattgcctcaacttgtggac
atggcagcacagatcgctgccggcatggcctacatcgagcggatgaactacatccaccga
gacctgcgagctgccaatatcctggtcggagacggtctggtctgtaagattgcagatttc
ggtctggctagactgatcgaggacaacgagtacacagctagacaaggagcgaagtttccc
attaagtggactgcaccggaggcggctctctatggtaaattcaccatcaaatcagacgta
tggtctttcggcatcctgttgacggagctgattaccaagggcagagtgccatatccagga
atgaacaaccgagaggtgctggagcaggtggagcgcggataccgtatgccgtgtccgcag
ggctcgccggcatctctgcacgagctcatgcttcagtgctggaggaaagaccccgatgag
aggcacacattcgagtatctgcagagcttcctggaggattacttcaccgccaccgagccc
cagtaccagcccggagagaacctgtga

DBGET integrated database retrieval system