KEGG   Danio rerio (zebrafish): 337685Help
Entry
337685            CDS       T01004                                 

Gene name
ogt.1
Definition
(RefSeq) O-linked N-acetylglucosamine transferase isoform 1
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    337685 (ogt.1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    337685 (ogt.1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    337685 (ogt.1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     337685 (ogt.1)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   337685 (ogt.1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     337685 (ogt.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_8 TPR_17 TPR_12 TPR_14 TPR_19 TPR_16 TPR_7 TPR_10 TPR_9 TPR_6 NARP1 TPR_MalT TPR_15 FAT MIT TPR_21 Wzy_C_2 SNAP BTAD ANAPC3 EST1_DNA_bind Tcf25 SUKH_5
Motif
Other DBs
NCBI-GeneID: 337685
NCBI-ProteinID: NP_001017359
ZFIN: ZDB-GENE-030131-9631
Ensembl: ENSDARG00000105243
Vega: OTTDARG00000020914
UniProt: Q5GA13
LinkDB All DBs
Position
14
AA seq 1062 aa AA seqDB search
MASSVGNVADSTEPTKRVLSFQGLAELAHREYQSGDFEAAERHCMQLWRQEPDNTGVLLL
LSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKP
DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACY
LKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARI
FDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLA
NALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEF
AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR
AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWT
DYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINALHK
PAYEHPKDLKASSGRLRVGYISSDFGNHPTSHLMQSIPGMHNSEKFEVFCYALSPDDGTN
FRVKVMAEAHHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQA
MWLAYPGTSGAPFMDYIVSDKATSPIEVAEQYSEKLAYMPNTFFIGDHANMFPHLKKKAV
IDFKSNGHIFDNRIVLNGIDLKAFLESLPDVKVVKMECDGQEVADSNGALSMPIIPMNTA
AEAIINMINQGQIQVTINGFTVSNGLATTQIFTVEEVVVSGTVALQINNKAATGEEVPRT
IVVTTRSQYGLPEDSIVYCNFNQLYKIDPPTLQMWANILKRVPNSVIWLLRFPAVGEPNI
QQYAQNLGLPASRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTM
PGETLASRVAASQLTCLGCPELIAQSRQEYEDVAVKLGTDMEFLKKVRARVWKQRICSPL
FNTKQYTMDLEKLYLQMWENHASGGKPDHLVKMQSLETSEST
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctcggtggggaacgtggctgacagcacagaaccaaccaaacgtgttctttcc
ttccaagggttggcagagctggcgcaccgtgaatatcagtcaggagattttgaggcagca
gagcgccactgtatgcagctgtggaggcaagagccggataatactggtgtgcttctgctg
ctctcctctatccacttccagtgtcgcaggctagacaggtcagctcacttcagcacactg
gccatcaagcagaaccccatgctagctgaggcctactctaacctgggcaatgtttacaag
gagagaggtcaactgcaggaggccattgaacactatcgtcacgctcttcgtctcaaacca
gacttcatcgatggatacattaacctggcagctgcattggtggcagcaggggacatggag
ggagcagttcaagcatatgtgtctgctcttcagtataatcctgatctatattgtgtacgc
agtgacttgggtaacctgcttaaagcgcttgggcgccttgaagaagccaaggcttgttac
ctgaaggcaatcgaaactcagccaaacttcgctgttgcctggagtaacctgggctgtgtg
ttcaatgcccagggtgagatctggctggccatccatcattttgagaaggcagtgacactg
gacccaaactttttggatgcttacatcaacttgggtaatgttctgaaagaggctcgtatc
tttgacagagccgttgctgggtatctgcgagcccttagtctgagcccaaaccacgctgtt
gtccatggaaacctggcttgtgtttattatgaacagggtctgatcgacctagccattgac
acataccgtcgtgccattgagctgcagccacactttcctgatgcatactgcaatcttgct
aatgctctgaaagaaaaaggcaatgtttctgaagctgaggagtgttacaacactgctctg
cgtctgtgcccgacccacgctgactcccttaacaatctggccaacatcaagcgtgagcag
ggcaacattgaggaggctgtgcagctctacaggaaagcactggaggtgttcccagaattt
gccgctgctcattcaaaccttgccagtgtcctgcagcagcaaggaaagcttcaagaagcc
ctcatgcactataaggaggccatcagaatcagccctacatttgcggatgcttactccaac
atgggcaacactttgaaagagatgcaggatgttcagggggcgctgcaatgctacactcga
gccattcagattaatcctgcttttgctgatgctcacagtaatttggcttccatacacaaa
gactctgggaacattcctgaagcaattgcatcttatcgcactgcgctgaagctcaagcca
gatttcccagatgcttattgtaaccttgctcattgtctacagattgtatgtgattggact
gattatgacgagcgcatgaagaaactggtgagcattgttgctgatcagttggagaagaac
cgcctgccatctgtgcatccgcatcacagcatgctttatcccctctctcacggtttccgc
aaggccattgcagagagacatggcaacttgtgtcttgacaagatcaatgctcttcataaa
cctgcttatgagcatccaaaggacctgaaagccagttcaggccgattgcgagtaggttac
attagctcagattttggcaaccatcctacttcccatcttatgcaatccattcctggcatg
cacaactctgagaagtttgaggttttctgctatgctctcagccctgatgacggcaccaac
tttagagttaaagtcatggcagaggctcatcacttcattgacctttcacagattccctgt
aatggaaaagctgcagacaggatccatcaagatggaatccacatcctggtcaacatgaat
ggctatacaaaaggagcacgcaatgagctgtttgcattgcgcccagcgcccattcaggcc
atgtggcttgcatacccaggcaccagtggagctccatttatggactacattgtcagtgat
aaggcaacgtctcccattgaggttgctgagcagtactcagagaaactggcatacatgccg
aatactttcttcattggagatcatgctaacatgttccctcaccttaagaaaaaggctgtt
attgacttcaaatcaaatgggcacatttttgacaatcgcattgttctgaatggcattgat
ctgaaagccttcctggaaagcctgccggatgtcaaagttgtgaagatggaatgtgatggt
caagaggttgctgacagtaatggtgccctttccatgcccatcatccctatgaacacagca
gctgaggccatcattaacatgattaaccaaggccagatccaagtcaccatcaatggcttt
accgtcagcaatggcctggccaccacacagatttttacagtggaggaggttgtagtatct
gggactgtagcgttgcagattaacaataaagcagcaacaggagaagaagttcccagaacc
attgtggtgaccacccgctcacaatatggccttcctgaagactctattgtctattgcaac
ttcaaccagctctataagattgaccctccaaccctgcagatgtgggccaatatcctgaag
cgtgtgcccaacagtgtgatctggctgctgcgcttcccagccgtgggtgagcccaatatc
cagcaatacgctcagaacctgggcctgcctgcctctcgcatcatcttctctcctgtggct
cccaaagaggagcatgtacgacgtggacagttggctgatgtgtgcctggacaccccgctc
tgtaatggccacaccacaggcatggatgtgctgtgggctggtacccccatggttacaatg
ccaggagagacgttggcttcacgcgtcgctgcttctcagctcacctgtcttggctgtcct
gaactcatcgctcagagccgtcaggagtatgaagatgttgcagtaaagcttggcactgat
atggaattcttgaagaaggtgcgtgcccgcgtctggaagcagcggatctgcagcccgctc
ttcaacaccaaacagtacaccatggacctagagaaactttacctgcagatgtgggagaat
cacgctagcggaggcaaacctgaccacctggtcaaaatgcagtctctggagaccagcgag
agcacctga

KEGG   Danio rerio (zebrafish): 652952Help
Entry
652952            CDS       T01004                                 

Gene name
ogt.2
Definition
(RefSeq) UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit isoform X1
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    652952 (ogt.2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    652952 (ogt.2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    652952 (ogt.2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     652952 (ogt.2)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   652952 (ogt.2)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     652952 (ogt.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_17 TPR_8 TPR_12 TPR_14 TPR_16 TPR_19 TPR_7 TPR_10 TPR_9 TPR_6 NARP1 TPR_4 TPR_MalT TPR_15 MIT TPR_21 TPR_3 Wzy_C_2 SNAP EST1_DNA_bind BTAD ANAPC3 Tcf25 Nsp1_C SUKH_5
Motif
Other DBs
NCBI-GeneID: 652952
NCBI-ProteinID: XP_001921543
ZFIN: ZDB-GENE-051128-1
Ensembl: ENSDARG00000099455
Vega: OTTDARG00000020897
UniProt: A0A0R4IVJ0
LinkDB All DBs
Position
14
AA seq 1102 aa AA seqDB search
MITGQLRKTFSLFAYKEQTFRRKRLLPPVTSAISLETEKPCFAQNTAMDPVKSEGEMASS
VGNAADSTEPTKHVLSFQGLAELAHREYQSGDFEAAEHHCMQLWRQEPDNTGVLLLLSSI
HFQCRRLDMSFQFSTLATKQNPMLAEAYSNLGNVHKERGQLQEAIERYRQALRLKPDFID
GYINLAAALVAAGDMEGAVQAYVSALHCNPDLYCVRSDLGNLLKALGRLEEAKRCYLKAI
ETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDASFLDAYINLGNVLKEARIFDRA
VAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRHAIELQPHFPDAYCNLANAMK
EKCNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPDFAAAH
SNLASVLQQQGKLQEALMHYEEAIRISPTFADAYSNMGNTLKEMQDIQGALRCYTRAIQI
NPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDE
RMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINALHKTAYE
HPKDLKASSGRLRVGYISSDFGNHPTSHLMQSIPGMHNSEKFEVFCYALSPDDGTNFRVK
VMAEAHHFIDLSHIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQVMWLG
YPGTSGAPFMDYIVGDKVTSPIEVAKQYSETLVYMPNSFFIGDHANMFPHLKKKAIVDIK
SNGHIFDNRIVLNGIDLKVFLESLPDVKVLKMECDDQVAADSNGALSMPIIPMNTAAEAI
INMINQGQIQVTINGFTVSNGLATTQINNKAATGEEVLKTIVVTTRSQYGLPDDSIVYCN
FNQLYKIDPPTLQMWANILKRVPNSVIWLLRFPAVGEPNIQQYAQNLGLPASRIIFSPVA
PKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASCVAASQLTCLGCP
ELIARSRQEYEDIAVKLGTDMEFLKKVRARVWKQRICSPLFNTKQYTVNLEKLYLQMWEN
HASGGKPDHLVKMQSLETSEST
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgataactgggcaactacgcaagacgtttagtttgtttgcgtacaaggaacaaacgttc
agaaggaaaaggctgcttcccccggttacatccgccatttcgctggaaactgaaaagcct
tgttttgctcaaaataccgcaatggatccagtaaagagtgaaggagagatggcgagctcg
gtgggaaacgcggctgacagcacagaaccaaccaaacatgttctttccttccaagggttg
gcagagctggcgcaccgtgaatatcagtcaggagattttgaggcagcagagcaccactgt
atgcagctgtggaggcaagagccggataatactggtgtgctgctgctgctctcctctatc
cacttccagtgtcgcaggctagacatgtcatttcaatttagcactctggccaccaagcag
aaccccatgctagctgaggcctactctaacctgggcaacgttcacaaggaacgaggtcaa
ctgcaggaggccattgaacgttatcgtcaagctcttcgtctcaaaccagacttcatcgat
ggatacatcaatctggcagcggctttggtggcagcaggggacatggagggagcagttcaa
gcatatgtgtctgctcttcattgtaatcctgatctgtattgtgtacgcagtgacctgggt
aacctgcttaaagcgcttgggcgccttgaagaggcaaagcgttgttacctgaaggcaatt
gaaactcagccaaactttgctgttgcctggagtaacctgggctgcgtgttcaatgcccag
ggtgagatctggctggccatccatcattttgaaaaggcagtgacattggacgcaagcttt
ctggatgcttacatcaacttgggtaatgttctgaaagaggctcgtatctttgacagagcc
gttgctgcgtatctgcgagcccttagtctgagcccaaatcacgcggttgtccatggaaac
ctggcttgtgtgtattatgaacagggtctgatcgacctggccattgacacataccgtcat
gccattgagctgcagccacactttcctgatgcatactgcaatcttgctaatgctatgaag
gaaaaatgcaatgtttctgaagctgaagagtgttacaacactgctctgcgtctgtgccca
acccacgctgattcccttaacaatctggccaatatcaagcgtgagcagggcaacattgag
gaggccgtgcagctctacaggaaagcactggaggtgttcccagattttgctgctgcccat
tcaaaccttgccagtgtcctgcagcagcaaggaaaacttcaagaagccctcatgcattat
gaggaggccatcagaatcagccccacatttgcggatgcttactccaacatgggcaacact
ctgaaagagatgcaggatattcagggggcactgcggtgctacactcgagccattcagatt
aaccctgcttttgctgatgctcacagtaatttggcttccatacacaaagactctgggaac
attcctgaagcaattgcatcttatcgcactgcgctgaagctcaagccagatttcccagat
gcttattgtaaccttgctcattgtctacagattgtatgtgattggactgattatgacgag
cgcatgaagaaactggtgagcattgttgctgatcaattggagaagaaccgcctgccgtct
gtgcatccgcatcacagcatgctttatcctctctcacacggtttccgcaaggccattgca
gagagacatggcaacttgtgtcttgacaagatcaatgctcttcataaaactgcttatgag
catccaaaggacctgaaagccagttcaggtcgattgcgagtgggttacattagctctgac
tttggcaaccatcctacttcccatctcatgcaatcaatccctggcatgcacaactctgag
aagtttgaggtgttctgctatgctctcagcccagatgacggcaccaacttcagagttaaa
gtcatggctgaggctcatcacttcattgacctttcacatattccctgtaatggaaaagct
gcagacaggatccatcaagatggaatccacatcctggtcaacatgaacggttatactaaa
ggagcacgcaatgagctgttcgcattgcggccagcacccattcaggtcatgtggcttgga
tacccaggcaccagtggagctccatttatggactacatagttggggataaggtgacttct
cccattgaggttgcaaagcagtactcagagactctggtgtacatgccaaattcatttttc
attggggatcatgctaacatgttcccacaccttaagaaaaaagcaattgtcgacatcaag
tcaaatgggcacatttttgacaatcgcattgtgctgaatggcattgatctaaaagtgttc
ctggaaagcctgccggatgtcaaagttttgaagatggaatgtgatgatcaagtggcggct
gatagtaatggtgccctgtccatgcccatcatccctatgaacaccgctgctgaggccatc
attaacatgattaaccaaggccagatccaggtcaccatcaacggctttaccgtcagcaat
ggcctggccaccacacagattaacaataaagcagcaacaggagaagaagttcttaaaaca
attgtggtgaccacccgctcacaatatgggcttcctgatgattcaattgtctattgcaac
ttcaaccagctctataagattgaccctccaaccctgcagatgtgggccaatatcctgaag
cgtgtgcccaacagtgtgatctggctgctgcgcttcccagccgtgggtgagcccaatatc
cagcagtacgctcagaatctgggcctgcctgcctctcgcatcatcttctctcctgtggct
cccaaagaggagcatgtacgacgtggacagttggctgatgtgtgcctggacaccccgctt
tgtaatggccacaccacaggcatggacgtgctctgggctggaacccccatggttacaatg
ccaggagagacgttggcttcatgtgttgctgcatctcagctcacctgtcttggctgtcct
gaactcatcgcccggagccgtcaggagtatgaagacattgcagtaaagcttggcactgat
atggaattcctgaagaaggtgcgtgcccgcgtctggaagcagcggatctgcagccctctc
ttcaacaccaaacagtacaccgtgaacctggagaaactttacctgcagatgtgggagaat
cacgctagcggaggcaaacctgaccacctggtcaaaatgcagtctctggagaccagcgag
agcacctga

KEGG   Danio rerio (zebrafish): 798087Help
Entry
798087            CDS       T01004                                 

Gene name
eogt
Definition
(RefSeq) EGF domain-specific O-linked N-acetylglucosamine transferase isoform X1
  KO
K18134  EGF domain-specific O-GlcNAc transferase [EC:2.4.1.255]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    798087 (eogt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    798087 (eogt)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     798087 (eogt)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   798087 (eogt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF563 Stealth_CR2
Motif
Other DBs
NCBI-GeneID: 798087
NCBI-ProteinID: XP_005155877
ZFIN: ZDB-GENE-120813-8
Ensembl: ENSDARG00000022853
Vega: OTTDARG00000035569
UniProt: X1WGG5
LinkDB All DBs
Position
11
AA seq 519 aa AA seqDB search
MLLLVALCLLCNNKTVSATDSSRTPQLDYNSLALPQRHIPFFLHNNKPLAKLCKEDPLCP
FKDALLLRKACWGYEKSCSAEHRFSYPVCTSLDSGWANSIQAAQELFWKQADFGYVRERL
NEMKTLCKPSKPADSSLKCSSHMRFCRATNLYLDLRSPRRGHERYKEDFLEQGEIGGHCS
LYSKALEAEGTHKSPLQSWFAELQTYSELDFHPLDDGHCDVIIDRPTVFMKLDAGVNMYH
HFCDFVNLYISQHLNNSFSRDINIVMWDTSVYGYGDLFSETWQAFSDYDIIHLKNLDSKR
VCFRDAFFSLLPRMRYGLFYNTPLISDCHSEGLFRAFSQHVLHRLSVPQDGPKQGQVRVT
LLARSTEYRRIINQQELINALKTVPLFEVKLVDYKYKEMPFLEQIHVTHNSDIFIGMHGA
GLTHLLFLPDWAVIFELYNCQDESCYRDLARLRGVQYMTWQKRDKVFPQDKGHHPTLGEH
PKFTNYTFDVEEFMRLVLLAAEHVTRHPDWRAKQSREEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttctggtagctctttgcctgctctgcaataataaaaccgtctcggccacagac
agcagccgcacgccacagctggactacaacagcctggctctgccgcagcgacatattcct
ttctttctacacaacaacaaacctctggccaaactctgcaaagaggacccgctttgccct
tttaaagatgctctgctgctcaggaaggcctgttgggggtatgaaaagagctgctctgct
gagcacaggttcagctatcctgtgtgcaccagtcttgattcaggatgggcaaactctatt
caggcagcccaggaactgttctggaaacaggcagatttcggctacgtgagggaacgtctc
aatgagatgaagacattgtgcaagccgtcgaaacccgctgattcctctctgaagtgctct
agtcatatgcggttctgcagggccacaaatctgtatctggacctgaggagtccccgcaga
ggtcacgagaggtataaagaggatttcctggagcagggtgagatcggcggtcactgcagc
ctttacagtaaagctttagaggcagaagggacacataagagtcccctacagtcttggttt
gctgaattgcaaacatattcagagcttgacttccatcccctggatgatggccattgtgat
gttatcattgacagaccaactgtcttcatgaagctggatgcaggagtgaacatgtaccat
catttctgtgactttgttaatctctacatctcccaacaccttaacaactccttcagccgt
gacataaacatcgtcatgtgggacacaagtgtatatggatatggagacctcttcagtgaa
acgtggcaagccttcagcgactatgacatcattcacctcaaaaacttagactccaaaagg
gtttgtttcagagatgcgtttttctctctccttccaagaatgcgatatggccttttctac
aacactcctcttatctctgactgccacagtgaggggctgttcagggccttttctcagcat
gtccttcatcgactcagtgtcccacaagatggacccaagcagggccaggttcgtgtcact
ctgttggcaagaagcacagagtaccgtcggataataaaccagcaggagcttatcaatgcc
ctgaagactgtgcctttatttgaggtcaagctggtggattacaaatacaaggagatgcct
tttctggagcagatccacgtcacacacaactctgatatctttattgggatgcacggagcc
ggactgacccacctcctctttcttcctgactgggccgtcatttttgaattgtacaactgt
caggatgagagctgctaccgtgatctggcccgactgaggggagtccagtacatgacttgg
cagaaaagggacaaagtgttcccacaggataagggtcatcaccctactcttggagaacat
cctaagttcaccaactacacttttgacgtggaggagttcatgcgtttagttcttctagca
gctgaacatgtgactcgacacccggactggagagctaaacaaagtcgagaagaactgtag

DBGET integrated database retrieval system