KEGG   Danio rerio (zebrafish): 360144
Entry
360144            CDS       T01004                                 

Gene name
mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04114  Oocyte meiosis
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04350  TGF-beta signaling pathway
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04520  Adherens junction
dre04540  Gap junction
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04916  Melanogenesis
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    360144 (mapk1)
   04012 ErbB signaling pathway
    360144 (mapk1)
   04350 TGF-beta signaling pathway
    360144 (mapk1)
   04370 VEGF signaling pathway
    360144 (mapk1)
   04371 Apelin signaling pathway
    360144 (mapk1)
   04068 FoxO signaling pathway
    360144 (mapk1)
   04150 mTOR signaling pathway
    360144 (mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    360144 (mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    360144 (mapk1)
   04210 Apoptosis
    360144 (mapk1)
   04218 Cellular senescence
    360144 (mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    360144 (mapk1)
   04520 Adherens junction
    360144 (mapk1)
   04540 Gap junction
    360144 (mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    360144 (mapk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    360144 (mapk1)
   04621 NOD-like receptor signaling pathway
    360144 (mapk1)
   04625 C-type lectin receptor signaling pathway
    360144 (mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    360144 (mapk1)
   04912 GnRH signaling pathway
    360144 (mapk1)
   04914 Progesterone-mediated oocyte maturation
    360144 (mapk1)
   04916 Melanogenesis
    360144 (mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    360144 (mapk1)
   04270 Vascular smooth muscle contraction
    360144 (mapk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    360144 (mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    360144 (mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    360144 (mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    360144 (mapk1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     360144 (mapk1)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   360144 (mapk1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     360144 (mapk1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   360144 (mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 360144
NCBI-ProteinID: NP_878308
ZFIN: ZDB-GENE-030722-2
Ensembl: ENSDARG00000027552
Vega: OTTDARG00000015839
UniProt: Q7ZW72
LinkDB
Position
5
AA seq 369 aa
MATAAVSAPAGGGPNPGSGAEMVRGQAFDVGPRYSNLSYIGGGAYGMVCSAYDRDNKVRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRTPTIDQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRSKVPWNRLFPNADPKALDLLD
KMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEET
ARFQPGYRP
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcgacagctgcggtttctgcccctgctggcggcggcccgaaccccggatccggtgcc
gagatggtccgcgggcaggctttcgatgtcgggccgcgttacagcaacctctcctacatc
ggaggaggcgcttacggcatggtttgttcagcatatgaccgtgacaataaagtacgtgtg
gcgatcaagaagatcagcccgtttgagcaccagacgtactgtcagcgcacactgcgtgag
attaaaatcctgctccgcttcaagcatgaaaacatcatcggtatcaacgacatcatccgc
acgcccaccatcgaccagatgaaagacgtttacatcgtacaggacctgatggagacagac
ttgtacaagctgttgaagacgcagcacttgagcaatgaccacatctgttacttcctgtat
cagatcctgcgcggcctgaagtacatccactccgcaaacgttcttcaccgagacctgaag
ccatcaaacctgttgctcaacactacctgtgacctcaagatctgtgattttgggctcgct
cgggtggctgatccagatcatgaccacaccggcttcctgacggagtatgtagccacacgt
tggtaccgcgcaccagaaattatgctcaattctaagggttacactaaatccattgatata
tggtctgttggttgtattctggctgagatgctttcaaatagacccatcttccccgggaaa
cactatctggaccagcttaaccacatcttaggtattttgggctccccttctcaggaggac
ctgaactgcatcatcaacattaaagcaagaaattacctgctgtcccttcctctccgcagc
aaagtgccctggaaccgcctgtttcccaacgcagaccctaaagcgctggacctgttggat
aagatgttgacctttaacccccataagaggattgaggtggaggaagcgctcgctcacccg
tacctggagcagtactatgatcctacagatgagcctgttgctgaggctccgttcaagttc
gacatggagctggatgatttgcccaaagagactctgaaagagctgatctttgaagagacc
gcacgcttccagccaggctacagaccatag

KEGG   Danio rerio (zebrafish): 399480
Entry
399480            CDS       T01004                                 

Gene name
mapk3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04114  Oocyte meiosis
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04350  TGF-beta signaling pathway
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04520  Adherens junction
dre04540  Gap junction
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04916  Melanogenesis
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    399480 (mapk3)
   04012 ErbB signaling pathway
    399480 (mapk3)
   04350 TGF-beta signaling pathway
    399480 (mapk3)
   04370 VEGF signaling pathway
    399480 (mapk3)
   04371 Apelin signaling pathway
    399480 (mapk3)
   04068 FoxO signaling pathway
    399480 (mapk3)
   04150 mTOR signaling pathway
    399480 (mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    399480 (mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    399480 (mapk3)
   04210 Apoptosis
    399480 (mapk3)
   04218 Cellular senescence
    399480 (mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    399480 (mapk3)
   04520 Adherens junction
    399480 (mapk3)
   04540 Gap junction
    399480 (mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    399480 (mapk3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    399480 (mapk3)
   04621 NOD-like receptor signaling pathway
    399480 (mapk3)
   04625 C-type lectin receptor signaling pathway
    399480 (mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    399480 (mapk3)
   04912 GnRH signaling pathway
    399480 (mapk3)
   04914 Progesterone-mediated oocyte maturation
    399480 (mapk3)
   04916 Melanogenesis
    399480 (mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    399480 (mapk3)
   04270 Vascular smooth muscle contraction
    399480 (mapk3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    399480 (mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    399480 (mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    399480 (mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    399480 (mapk3)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     399480 (mapk3)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   399480 (mapk3)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     399480 (mapk3)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   399480 (mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 399480
NCBI-ProteinID: NP_958915
ZFIN: ZDB-GENE-040121-1
Ensembl: ENSDARG00000070573
Vega: OTTDARG00000032785
UniProt: Q7ZVK8
LinkDB
Position
3
AA seq 392 aa
MAESGSSAAAAGAAGSNSSAAGPGGAVAPGGPSGAAGSKPGLESVKGQNFDVGPRYTDLQ
YIGEGAYGMVCSAFDNVNKIRVAIKKISPFEHQTYCQRTLREIKILLRFHHENIIGINDI
LRARHIDYMRDVYIVQDLMETDLYKLLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRD
LKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSI
DIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSQDDLNCIINMKARNYLQSLPQ
KPKIPWNKLFPKADNKALDLLDRMLTFNPLKRINVEQALAHPYLEQYYDPSDEPVAEEPF
TFNMELDDLPKEKLKELIFEETARFQANYQGS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcggaatcgggcagtagcgcggcggcggccggagccgcgggctcgaatagcagcgcc
gccgggcctggaggagccgtcgcacctgggggaccaagcggagcggcaggatccaagcct
ggcctggagtcggtgaagggacaaaattttgatgttggcccccgatacactgatctccag
tacatcggggagggggcctacgggatggtctgctcagcttttgataatgtgaataagatc
cgagtggccattaagaagataagtccatttgaacaccagacctactgccagcgcaccctg
agagagatcaaaatcctcctgcggttccatcatgagaacatcatcgggatcaatgacatc
ctgagagctcgccacattgattatatgagggatgtctatatcgtacaggacctgatggag
accgacctttataaactgctgaagacacagcaactcagcaacgaccatatctgctacttt
ctgtatcagatcctgcgagggctgaagtacattcactctgccaatgtgctgcacagagac
ctgaagccctcaaaccttctcatcaacaccacctgtgacctcaagatctgtgattttggg
ttggcgaggatagctgaccctgaacatgaccacactggattcctcacagagtatgtggct
actcgctggtaccgtgcccctgagatcatgcttaactccaagggctacaccaagtccatt
gatatttggtctgtgggatgcatcctggctgagatgttgtccaacagacccatcttccct
gggaagcactatctggaccagctcaaccatatattgggtgttctgggctccccctctcaa
gatgatctgaactgcatcatcaacatgaaggccaggaactacctccagtctttaccacag
aaacccaagatcccatggaacaagctgtttcccaaagcagacaacaaagctttggattta
ttggatcgcatgttaacctttaaccctcttaaacgtataaatgtggagcaagcactggcc
cacccctacctggagcagtactatgacccatctgatgagccggtagctgaggaacccttc
actttcaacatggagctggacgaccttcctaaagagaagctgaaagagctcatctttgag
gagacggcacgcttccaggccaattaccagggctcctga

DBGET integrated database retrieval system