KEGG   Danio rerio (zebrafish): 368329
Entry
368329            CDS       T01004                                 

Gene name
cdkn1bb
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1Bb
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    368329 (cdkn1bb)
   04068 FoxO signaling pathway
    368329 (cdkn1bb)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    368329 (cdkn1bb)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 368329
NCBI-ProteinID: NP_997957
ZFIN: ZDB-GENE-030521-13
Ensembl: ENSDARG00000054271
Vega: OTTDARG00000021145
UniProt: Q90YX4
LinkDB
Position
25
AA seq 179 aa
MSNVRLSNGSPTLERMEARLSDQPKPSACRNLFGPVDHEELKKDFQRQLRTMEDASAEAW
NFDFSTHTPRADGRYQWEALDIRSVPGFYSRSERGKGSDIHISSSGNNNDNNVDVNGNHD
CRVTEQSAETPETLREPRKRSSCLDSSCQSKRSHICVDEVTRTPRKPKKPRKPLSPTPT
NT seq 540 nt   +upstreamnt  +downstreamnt
atgtccaatgttcgcttgtctaatggcagcccgacgctggagcggatggaggcgcgactg
tctgaccaaccgaagccgtcggcatgtcgaaacctgttcgggccggtggatcatgaagag
ctgaagaaggacttccagcggcagctccggacgatggaggacgcgtcggctgaagcctgg
aacttcgacttttccacgcacacgccgcgcgccgacggtagatatcagtgggaagcgctg
gatattcgctcggtgcccggtttctacagccgatcggagcgggggaagggctccgatatt
cacatctcctcctctgggaataataacgacaataacgtggatgttaacgggaatcacgac
tgtagggtaacggagcaaagcgcggagacgcccgaaacgctccgagagccgaggaaaaga
agctcctgtctcgactcatcgtgtcaaagcaaacgctcgcacatctgtgtggatgaagtg
acccgaacgcccagaaaacccaaaaaacccagaaaaccattgagtccgacacccacataa

KEGG   Danio rerio (zebrafish): 402862
Entry
402862            CDS       T01004                                 

Gene name
cdkn1ba
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1Ba
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    402862 (cdkn1ba)
   04068 FoxO signaling pathway
    402862 (cdkn1ba)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    402862 (cdkn1ba)
SSDB
Motif
Pfam: CDI DUF4005 Rad50_zn_hook
Other DBs
NCBI-GeneID: 402862
NCBI-ProteinID: NP_001013286
ZFIN: ZDB-GENE-040812-3
Ensembl: ENSDARG00000029018
Vega: OTTDARG00000008137
UniProt: Q5RGY9
LinkDB
Position
4
AA seq 187 aa
MSKVRVSNGSPTLERVDPRQADHGKPPVCRSLFGAVDRQEFAKDVREQMREIERASAEKW
NYDFAENRPLAPGDYEWQEVDADEVPDFYTRPPRVKRPSSAGTVDHNGNHDYFLTAPSPS
PESGAGNSERADAGNRSLSTPRKRPSTEDQDDLRRSKRPSVHASEADPCPDATSSLERAP
CEPDPKT
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtcaaaagtgcgcgtctccaatggaagtccgacgctggagcgagtggaccccaggcag
gcggatcacggcaagccgcctgtctgccgaagtctcttcggcgccgtggaccgccaagag
ttcgccaaggatgtacgggagcaaatgcgggagatcgagagagcgtccgcggaaaagtgg
aattacgacttcgccgaaaaccgaccgctcgcgccgggcgactacgagtggcaggaggtg
gacgccgacgaagtgccggacttttacaccagaccccctcgcgtaaaacggccctcttcg
gccgggactgtggatcataacgggaaccacgattatttcttgacggctccctctccgtcc
ccggagagcggagcggggaactccgaacgcgcggacgccgggaaccgctcgctcagcacg
ccgaggaaacgaccgtcgacggaagatcaggatgatcttcgccgaagcaaaagacccagc
gtccacgcgagcgaggccgacccctgtccggacgcgacgagctcgctcgagcgcgctccc
tgcgaaccggaccccaaaacgtaa

DBGET integrated database retrieval system