KEGG   Danio rerio (zebrafish): 369197
Entry
369197            CDS       T01004                                 

Gene name
stat5a
Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11224  signal transducer and activator of transcription 5B
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    369197 (stat5a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    369197 (stat5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    369197 (stat5a)
Transcription factors [BR:dre03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    369197 (stat5a)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 369197
NCBI-ProteinID: NP_919368
ZFIN: ZDB-GENE-030820-2
Ensembl: ENSDARG00000019392
UniProt: Q68SP3
LinkDB
Position
3
AA seq 785 aa
MAVWIQAQQLQGDALHQMQSLYGQHFPIEVRHYLSQWIEGQLWDAIDLENPQEELKAKRL
LDSLIQELQKKAEHQVGEDGFLLKIKLGHYASQLKSTYDRCPLELVRCIKHILYTEQRLV
REATNSSSPVGGLMDSMSQKYHQINQAFEELRILTQDTENDLRKLQHTQEYFIIQYQESL
RIQAQLSSLATLPPADRQLREPSLLSKRATVEAWLTREANTLQKYRLSLAEKHQKTLALL
RKQQTVILDDELIQWKRRQQLAGNGGPPEGGLDILQSWCEKLAETIWQNRQQIRRAEHLR
QQLPIPGPIEELLTDLNSTITDIISTLVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNMS
LKRIRRSDRRGAESVTEEKFTILFESQFSVGGNELGFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFIVPDKVLWAQLCEALNMKYKAEVQSNRGLCEENLVFLAQKAFSS
SSVNPDDYRNMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPHWNDGAILGFVNK
QQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPYTTKDFSIRSL
ADRISDLNHLLFLYPDRPKDEVFSKYYTPPLSKAVDGYVKPQIKQVVPEFATPNPDPAAN
PTYMDHVASSPAVSAPHPYGLYPPMADPMLDADGDFDLDDTMDVARHVEELLRRPMEGQW
SGQQS
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggccgtgtggattcaggcccagcagctgcagggagatgctctacaccagatgcagtct
ctctatggccaacacttccccatagaggtgcgacactacctgtcccagtggatagaggga
caactctgggacgcaatagatttagagaaccctcaagaggagcttaaagccaagcgcttg
ttggacagcctgattcaggaactacagaagaaagcagagcatcaagtcggagaggatgga
ttcttactcaagattaaattaggacattacgcttcacagctaaagagcacgtatgaccgc
tgtccgctggagctggtgagatgcatcaaacacatcctttacacggagcagagactcgtc
agagaggccactaattcgagttcaccggtgggcgggttaatggacagcatgtcacagaaa
taccaccagataaaccaggccttcgaggagctgcgaatactgactcaggacacagagaac
gacctcagaaaactacagcacacacaggagtacttcattatacaataccaggagagcctc
agaatacaggctcagttatcgagtctggcgacactgcctccagcagaccgacagctacga
gagcctagcctgctcagcaagagagccacagttgaggcctggctgacccgagaagctaac
accctgcagaaatacagactgagcttggcagagaaacaccagaagacactggcgttgctc
cgcaaacagcagacggtgattcttgacgatgagctgattcagtggaagagacgtcagcag
ctggctggaaacggcggcccgcctgagggaggactggacatactacagtcatggtgtgag
aagctggcagaaaccatttggcagaaccgtcagcagatccggcgagctgagcatctgagg
cagcagctgcccattccaggtcccattgaagagctgctgaccgacctcaacagcaccatc
acagacatcatctccactttagtcaccagtactttcatcatcgaaaagcagccgcctcag
gtgctgaaaacacaaacgaaatttgcagcgacggtgcgtctgctggtgggcggcaaactc
aacgttcacatgaacccaccgcaggttaaagccaccatcatcagcgaacaacaagccaag
gcccttctcaagaacgaaaacaccagaaacgacagcagtggcgagatcttgaataataac
tgtgtgatggagtaccatcagaccacaggcactctcagtgctcactttaggaacatgtct
ttgaagaggatcaggcgttcagacagacggggggcagaatctgttacagaagagaaattc
accattttgttcgaatcacagttcagcgttggtggaaatgagctggggtttcaggtgaag
actctttctcttcctgtggtggtaattgttcatggaagtcaagataacaatgccacggcc
accgttctatgggacaatgcctttgctgaaccgggacgggtgcctttcattgtgccagac
aaggtgttgtgggcgcagctgtgtgaagctctaaatatgaagtacaaggcagaggtgcag
tcaaaccgaggtctgtgtgaggagaatctcgtctttctcgcccagaaagccttcagcagc
tccagtgtgaatccagacgactatcgcaatatgacaatgacctggtcacagtttaacagg
gagagtttaccaggcaggaacttcacattttggcagtggtttgatggtgttatggagctt
actaaaaaacacctgaagcctcactggaatgacggggcgattcttggctttgtgaataaa
cagcaagctcaggatatgctgatgtccaaacccaacgggaccttcctgttgcgattcagc
gactcagaaatcggcggcatcactatagcctgggtggcggagaaccctaacaaagcaggg
gaaaggatggtgtggaacctcatgccatacacaaccaaagacttctctatccgctccctg
gcagatcgtatcagtgacctgaatcatctcttgttcctctaccctgaccgacccaaagat
gaggtcttctccaaatactacaccccacctctgtctaaagccgtggacggatacgtcaaa
ccgcaaatcaaacaagtagtgccagagtttgcgactccaaaccccgaccctgcagcaaac
cccacctacatggaccatgtagcatcatctccagctgtcagtgccccacacccttacgga
ctctatcctccaatggctgaccctatgctggacgctgatggggatttcgatctagacgac
accatggatgtagcgaggcatgtagaagagctgctccgtcgaccgatggagggccagtgg
agcggccagcagtcgtga

KEGG   Danio rerio (zebrafish): 445474
Entry
445474            CDS       T01004                                 

Gene name
stat5b
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    445474 (stat5b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    445474 (stat5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    445474 (stat5b)
Transcription factors [BR:dre03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    445474 (stat5b)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 STATa_Ig
Other DBs
NCBI-GeneID: 445474
NCBI-ProteinID: NP_001003984
ZFIN: ZDB-GENE-040818-1
Ensembl: ENSDARG00000055588
Vega: OTTDARG00000020565
UniProt: Q68SP2
LinkDB
Position
12
AA seq 787 aa
MALWIQAQQLQGDALHQMQSLYGQHFPIEVRQYLAQWLEAQPWDAIDLENQQDEFKAKRL
LDGLIQELQKKAEHQMGGDGFLLKIKLGHYATQLKNSYDACPLELVRCVKHILYTEQRLV
QEASNTSSPGSGPVDGTPQRYQQINQTFEELRVMTQDTENDLRKLQHSQEYFIIQYQESL
RIQAQIVSLASLPPTERAQREASLQSRKSTLETWLTREANTLQKYRQELAEKHQRTLALL
RKQQTVIVDDELIQWKRRQQLAGNGGPSEGGLDILQAWCEKLADMIWQNRQQIRRVEHLT
QQLPIPGPTEELLTELNAIVTDIISTLVTSTFIIEKQPPQVLKTQTKFSATVRLLVGGKL
NVHMNPPQVKATIISEQQAKAILKNENTRKSESSGDILNNNCVMEYHQTTGNLSAHFRTM
SLKRIKRSDRRGAESVTEEKFTILFESQFSVGVNELVFHVKTLSLPVVVIVHGSQDNNAT
ATVLWDNAFSEPGRVPFVVPDKVVWPQLCEALNMKYKSEVQSDRGLSEDNLVFLAQKAFS
SSSNNPEDYSSMTITWSQFNRESLPGRNFTFWQWFDGVIELMKKHLKSHWNDGAILGFLN
KQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPFTTKDFSIRS
LADRISDLNHLLFLYPSQPKEEVFSRYCTPPNSKAVGDGYVKPEIKQVVKVEFSSPNPEP
SPGNSFMDHAASPTVNQHHNFTIYPAMNDTMIDAEGEFDLDETMDMARQVEEFLRQPMET
TWSGQQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggcgctgtggattcaggcacagcagcttcagggggacgcccttcatcagatgcaatcc
ctctatggccagcacttccccattgaggtgcgccagtacttggcacaatggctggaggct
caaccatgggatgccatagatctggagaaccagcaggatgagtttaaagccaagcgtctg
ctggatggtctgatccaggagctgcaaaagaaagcagagcatcagatgggtggagatggc
tttctgcttaaaatcaaacttggccattatgccacacagctgaagaactcatatgatgct
tgccccctggagctggtgcggtgtgtcaaacacattttgtacaccgaacaaagacttgta
caggaagcatctaataccagcagtccaggttcaggtccggttgatgggaccccacagaga
tatcagcaaatcaaccagacgtttgaggagctgcgcgttatgactcaggacacagagaat
gacctccgcaagctccagcacagtcaagaatacttcatcattcagtaccaggagagtttg
aggatacaggctcagatagttagtctggccagccttcctcctactgagcgtgctcagaga
gaagcgagtctgcagagcaggaagtccacgctagagacctggctgacacgagaagccaac
actttacagaaatacagacaggagctggcggagaagcatcagaggaccctcgctctgctg
aggaaacagcaaaccgtgattgttgacgatgaactgatccagtggaagagacgacagcag
cttgcaggaaatggaggaccatcagaaggaggattggacatactgcaagcctggtgtgag
aagttggccgacatgatctggcaaaacagacagcagattcgtagagttgaacacttgact
cagcagctgcccataccgggacccacagaagaactgcttactgaactcaacgctattgtc
acagacatcatatcaacactcgtcaccagcacatttattattgagaagcagcctcctcaa
gtgctgaagacccaaaccaaattttcagcaacagttcggttgctggttggagggaagctc
aatgtccatatgaatcctccacaggttaaagccaccatcataagtgaacagcaggccaag
gcgatactcaagaatgaaaacacccgcaagagtgaaagcagcggagatattctaaacaac
aattgtgtgatggagtatcatcaaaccactggtaacctgagtgcacacttcagaaccatg
tctctgaaacgtattaagcggtcagaccgtcgtggtgcagagtcagtaactgaagagaag
tttacgattctttttgagtctcaattcagtgtgggagtaaatgaacttgtgtttcatgtg
aagacattatccctgcctgttgtggtcatcgttcatgggagtcaagacaataatgcaaca
gcgacagtattgtgggataatgctttctctgagccgggtcgagtgccatttgtggtgcct
gataaagtggtgtggccacagctgtgtgaggctcttaatatgaaatataaatcagaggtt
cagagcgacagaggcctttcagaagataatctggtgttcctcgctcagaaagccttcagc
agctccagcaacaatcctgaggactacagcagcatgaccatcacctggtctcagtttaat
agggagagtttaccaggcaggaactttacattttggcagtggtttgatggagtcattgaa
ttaatgaaaaaacatctaaagtctcactggaatgatggagcgattttgggttttctgaac
aagcagcaggctcaagacatgttgatgtccaaaccaaatggcacgttcctcctgcgcttc
agtgactctgaaattggaggaatcactattgcatgggtcgcagaaaacccgaacaaagca
ggggaacggatggtttggaacttgatgcccttcactaccaaagatttctccatccgctct
ctggccgatcgaatcagtgatctgaaccatttgctcttcctctatcccagtcagcccaaa
gaggaagtcttctcccgttactgcacacctccaaactctaaagcagtgggggatggatat
gtcaaaccagagatcaagcaggtggtaaaggttgagttttcctcacccaatcctgaacca
tctcctgggaattcttttatggatcatgcagcatctcccaccgtgaatcaacaccataac
ttcactatctatccagcaatgaatgacaccatgatagacgcagagggagaatttgacctg
gacgagaccatggacatggcccgacaggtggaggagtttctcaggcaacccatggaaacc
acgtggagtggacaacagtcgtga

DBGET integrated database retrieval system