KEGG   Danio rerio (zebrafish): 373082Help
Entry
373082            CDS       T01004                                 

Gene name
gys2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00500  Starch and sucrose metabolism
dre01100  Metabolic pathways
dre04910  Insulin signaling pathway
Module
dre_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    373082 (gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    373082 (gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    373082 (gys2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     373082 (gys2)
Glycosyltransferases [BR:dre01003]
 Polysaccharide
  Storage polysaccharide
   373082 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 373082
NCBI-ProteinID: NP_001018199
ZFIN: ZDB-GENE-030826-31
Ensembl: ENSDARG00000004904
Vega: OTTDARG00000008037
UniProt: Q5RGX8
LinkDB All DBs
Position
4
AA seq 701 aa AA seqDB search
MRLSRSLSITSLSGLPLFEEESLPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKITVDEWG
ENYFMMGPYYEHNFKTQVEKCEPPNQAIRAAMDSLINNGCQVHFGRWLIEGSPYVILFDI
GAAAWNLDRWKGDLWSACGIGLPYHDREANDSLILGSLVAWFFKELTDQLQDKLNVVAHF
HEWQAGTGLVLSRSRNLPLATIFTTHATLLGRYLCAGNADFYNNLDKFDIDREAGERQIY
HRYCLERAAVHCAHVFTTVSQITAVEADHMLHRNPDVVTPNGLNVRKFSAMHEFQNLHSM
NKSKIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFLESLSRLNYLLRVHKSD
VTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQSVKEKFGKKLYESLLRGEIPDMSKI
LDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSTDPILGNIRRIGLFNGRNDRVKIVFHP
EFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFME
EHVSDPSEYGIYIVDRRFRSADESCNQLTQFMFSFCQKSRRQRIIQRNRTERLSDLLDWR
YLGRFYMHARHLALSRSFPEKFRPEHLNLTSTQGFRYPRPSSVPPSPSASIHSTPHHSDE
EDDDTYDEEEEAERDRLNIKAPFSVGADTDGKRTQPVENGN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgcgactatccagatctttgtcaataacatcattaagtggacttccactgtttgaagag
gaaagtctacctgttgaagatctcctgctctttgaggttgcgtgggaagtcaccaataaa
gtgggaggaatttacactgttatccagacaaaagcaaagatcactgtggacgaatggggt
gaaaactacttcatgatgggaccttactatgaacacaacttcaagactcaggtggagaaa
tgtgaacctccaaaccaagccatcagagctgccatggactccctgatcaacaacggctgc
caggttcactttggccgttggctgattgagggcagtccatatgtgattctctttgacatt
ggtgctgccgcctggaacctggaccgctggaagggggatctgtggagcgcctgcggcatt
ggcctgccatatcatgaccgagaggccaacgactcactcatcctgggctctctggtggcc
tggttcttcaaagagttaacagaccagcttcaggacaagctcaatgtagttgctcacttc
catgagtggcaggctgggacaggactggtactgagccgctcccgaaatcttcccctggcg
actattttcaccactcatgccaccctgctgggtcgatacctgtgcgctggaaatgctgac
ttctacaacaacctggataagtttgacattgacagagaggctggagagagacagatctac
caccggtattgtttggagagagctgcggttcactgtgcgcacgtctttacaaccgtgtcc
caaatcacagcagtggaggccgatcacatgcttcacagaaacccagatgtcgtcaccccc
aacggcctgaatgttaggaagttttcagccatgcatgaattccagaacctgcactccatg
aacaaatccaagatccaggagttcgtaagaggacacttctatggtcatctggacttcaat
ctcgagaagacgctgttttttttcatcgctggacgatacgagttttctaataagggagca
gatctgtttctcgaatctctgtccagattaaactacttgctaagggttcataagagtgac
gttacagtggttgtgttttttatcatgcccgccaaaaccaacaactttaacgtggagtcg
cttaaaggacaggctgtacgcaagcaactgtgggacacggctcagtcggtgaaggagaag
tttggcaaaaagctttacgagagcttgttaaggggagaaatcccagacatgagcaaaatc
ctggacagagatgatttcaccatcatgaagagggccatttatgcaacacagcgacactct
cttcctccagtaacaactcacaacatgctggacgactccactgacccgatcctgggcaac
atccggcgtatcggcctcttcaatggacgcaacgacagagtaaagattgtgtttcatccc
gagttcctgtcctccaccagccccctgctgccaatggactatgaggagtttgtgcgcggc
tgccacctgggagtgttcccatcctactatgaaccatggggctacacaccaggtgagtgc
acagtcatgggaatccccagtgtgaccacaaatctatctgggtttggctgtttcatggag
gaacatgtttctgacccgtctgaatatggaatctacatcgtggaccggcggtttcgctct
gcggacgagtcgtgtaatcagctgacccagttcatgttttcattctgccagaagtcgcgc
aggcagagaataatccagcgtaaccgaacggagagactctctgatctgctggactggaga
tatcttggacgattctacatgcacgccagacatttggccctcagcagatccttccctgag
aaattccgaccggagcatctaaaccttacgtcgacgcagggtttccgttaccctcgacca
tcctctgttcctccgtctccgtcagcctccatccactccacccctcaccacagcgatgaa
gaggatgacgacacctatgatgaagaggaggaggccgagcgggacagactgaacatcaag
gccccgttcagtgtgggcgcagacaccgacggtaagaggacacaacccgtggaaaacggc
aattag

DBGET integrated database retrieval system