KEGG   Danio rerio (zebrafish): 373867
Entry
373867            CDS       T01004                                 

Gene name
plcg1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04370  VEGF signaling pathway
Module
dre_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    373867 (plcg1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    373867 (plcg1)
   04370 VEGF signaling pathway
    373867 (plcg1)
   04020 Calcium signaling pathway
    373867 (plcg1)
   04070 Phosphatidylinositol signaling system
    373867 (plcg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    373867 (plcg1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     373867 (plcg1)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    373867 (plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    373867 (plcg1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y PH SH3_1 C2 SH3_9 SH3_2 PH_12 GDPD EF-hand_like PH_14 Mcp5_PH
Other DBs
NCBI-GeneID: 373867
NCBI-ProteinID: NP_919388
ZFIN: ZDB-GENE-030421-3
Ensembl: ENSDARG00000038442
Vega: OTTDARG00000030387
UniProt: Q804J6
LinkDB
Position
23
AA seq 1312 aa
MAASAGFSSNGPVPWALSDTEVNNLYRDLELGTVLTLYYSKKSQRPERRTFQVKLETRQI
IWTRGTDKIEGEIDIREIKEIRTGQKSRDFERYVEDVTTRPDQAHCFVILYGTEFRLKSL
SLAATSDEEMVMWVKGLTWLMSDTLSSSTPLQIERWLRKQFYAVDRNREDRISCKDLKCM
LCQVNYRVPNMKFLREKLPDGELRNGDVSYSHFAQLYRSLMFDAQKSMEIPLLQRFIDRP
EQKISLEDFQNFLIEQQKELWAADSNKVQEYMFRYLKDPLREIEQPYFHQDEFLTYLFSK
ENTIWDAQLDQVRPEDMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIE
LDCWDGPDGMPVIYHGHTLTTKIKFSDVLNTIKEHAFVTSDYPIILSIEDHCSIVQQRNM
ATFFKKVFGEMLLTKAVDISADGLPSPHQLKRKILIKHKKLAEGSAYEEVSSSTPYSEND
ISNSIKNGILYLEDPINHEWYPHFFVLTSNKIYYSEETSSNQGNEDEEEHREICNGMDQH
VTEKWFHGKLGAGRDGRQIAERLLSEYCVETGAPDGSFLVRESETFVGDYTLSFWRSGRV
QHCRIHSRQEAGSPKFYLTDNLVFDTLFALITHYQQVPLRCNEFEMKLTEPVPQTNAHES
KEWYHACLSRSQAENMLMRVPRDGAFLVRKRTEFNSFAISFRAEGKIKHCRVQQEGQTVV
LGTSEFDSLVDLISYYEKHPLYRKMKLRYPINEETLEKIGTAEPDYGSLYEGRNPGFYVE
ANQMPTFKCTVKAMYEYKAQRDDELSFIKNAIISNVDKQEGGWWKGDCGGKKQLWFPANY
VEEISPTAVEPDRSASENSPLGDLLRGSVDVSSCQIVVRPEGKGSRQFVFSLVPVASPRT
GPVLDIAASSQEELKDWVVKIREVTMTSEAKLEEGKMMERRKKIALELSDLVIYCRPVPF
DEDKIGTERACFRDMSSFPETKAEKYVNRVKGKKFLQYNRLQLSRIYPRGQRLDSSNYDP
LPMWLCGSQLVALNFQTADKPMQMNQAIFMLNGRSGYVLQPPIMRDDNFDPFDRHSLRGV
EPITLSIEVLGARHLPKHGRGIVCPLIEIEVCGAEYDNAKQRTDSEADNGLNPTWTRKLF
RFTVCNPSFAFLRFVVYEIDMFSDQNFLAQATFPINCLKTGYRSVPLKNSYSEDLELACL
LVHMDVIRGRVGYEMIHENGDMLSPFSPAGAMAMAMQTGRERMNDSGSVSSTSSMSPLPS
SPAQALGYRGREGSFEARYQTPLEDFRVSQEALLDHENRRLRRARVSADNRA
NT seq 3939 nt   +upstreamnt  +downstreamnt
atggctgcgagcgcgggcttctcctccaatggacctgtaccctgggctctgagcgacacc
gaggtgaacaatctgtaccgggatctggagctgggcaccgtactcacgctctattactcc
aaaaagtcccagagacccgagaggaggacgtttcaagtcaagctcgagaccaggcagatt
atctggaccagaggaacggataaaatcgagggcgaaattgatatccgggagattaaggag
atccggactggacagaagtctcgggactttgagcgatatgtggaggacgtcacgacccgg
ccggaccaggcccactgcttcgtcatcctctacggcactgagtttcgcctcaaatccctc
agtctggcagcgacctcagacgaggagatggtgatgtgggtgaagggtctgacgtggctg
atgtccgatacgctgagctcctccacaccgctgcagattgaaaggtggctgagaaagcag
ttttacgcagtggatcgtaaccgagaggacagaatttcctgtaaggatctgaaatgtatg
ttgtgtcaggtcaactacagagtgcccaacatgaagttcctccgagagaaacttccggac
ggcgagctgaggaatggagacgtgtcgtacagtcatttcgctcagctataccgcagtctg
atgttcgacgcacagaaatcgatggagattccactgctgcagaggtttattgacagaccg
gagcagaagatctcgctcgaggacttccagaacttcctcattgaacagcagaaggagctg
tgggctgcagacagtaataaggtgcaggagtacatgttccgctacctgaaggatcctctg
agagagatcgaacagccctactttcaccaggacgagttcctcacctatctgttctccaaa
gaaaacaccatctgggacgctcagctggatcaggtgcggcccgaggacatgaacaacccc
ctgtcccactactggatctcctcgtcccacaacacctatctgacgggggaccagttttcc
agcgagtcgtctctggaggcgtacgcccgctgtctgcgcatgggctgcagatgcatcgag
ttggactgctgggacggtcctgacgggatgcctgtcatctatcacggtcacaccctcacc
accaagatcaagttcagtgatgtgctcaacaccatcaaagagcacgcattcgtcacgtct
gactatcccatcatcctctccatcgaggaccactgcagcatcgtccagcagagaaacatg
gccactttcttcaagaaggtgtttggggagatgctgctgaccaaagcggtggacatttca
gcagacggcctgccctcgccacaccagctcaagaggaagatcctcatcaagcacaagaag
ttagcggagggcagtgcgtacgaggaggtgtcgtcttcaacaccctactcagagaacgac
atcagcaactccatcaagaacggcatcctgtacctggaggaccccatcaaccacgagtgg
tatccacacttctttgttctgaccagcaataagatctattactctgaagagacgtccagt
aatcaagggaacgaggatgaggaggagcacagagagatctgcaacggtatggaccagcat
gtgacggagaagtggtttcatggtaaactgggtgcaggtcgtgacggccgtcagatcgca
gagcgcttgctgtctgagtactgcgtggagactggagctccagacggatccttcctagtg
cgggagagcgagacctttgtaggagactacaccctctccttctggcgctctggtcgtgtt
cagcactgcaggattcactctcgacaggaagcaggaagtcccaagttctacctgacggat
aacctggtgttcgacactctgtttgcgctcatcactcattaccagcaggttcctctgcgc
tgcaacgagttcgagatgaagctgaccgagccggtgccgcaaaccaacgctcacgagagc
aaagagtggtaccacgcgtgtctgtcccgcagtcaggctgaaaacatgttgatgagggtc
ccacgtgacggtgctttccttgttaggaagagaactgaattcaactctttcgccatttcc
ttccgggctgaagggaagatcaagcactgtcgcgtccagcaggagggacagacggtggtt
ttgggaacctcggagttcgacagtttagtcgatttaatcagttactatgagaaacatcca
ctgtaccgcaagatgaagctgcgctaccccatcaacgaggaaacactggagaagatcggc
actgctgagcctgattatgggtctctgtatgagggacgaaacccgggattctatgtggaa
gccaatcagatgcccacatttaagtgcacagttaaagccatgtatgaatacaaagcccag
cgggatgatgagctctctttcatcaagaacgccatcattagtaacgtggacaaacaggag
ggaggctggtggaagggtgactgcggtggaaagaagcaactgtggttcccggccaattat
gtggaggagatcagcccgacggcggtggagcccgacagatctgcctcagagaacagtcct
ctgggagatctcctgagaggaagtgtggacgtgtcttcctgtcagatcgtggtcagacct
gaagggaaaggcagtcgtcagttcgtcttctctctggtgccggtggcgtctcctcgcacc
ggtcctgtgctggacatcgcagccagctctcaggaggagctgaaggactgggtggtgaag
atccgagaggtcaccatgacatctgaagccaagcttgaagaggggaaaatgatggagaga
agaaagaagatcgctttagagctgtctgatctggtcatctactgccggccggttcctttt
gatgaagacaaaattgggacggagcgcgcctgtttccgggacatgtcctcctttcccgag
actaaagcagagaagtatgtgaaccgcgttaaagggaagaagttcctgcagtataaccgt
ctgcagctctcgcggatctacccgcgcggccagcgcctcgactcctccaactacgaccca
ttacccatgtggctgtgcggcagtcagctggtggccctcaacttccagaccgcagataaa
cccatgcagatgaaccaggccatcttcatgctgaacggcaggagtggatatgtgctgcag
ccgcccatcatgagggatgacaacttcgacccgtttgaccgccactcgctcagaggagtg
gagcccatcacactcagcatagaggttttgggagcgcgtcacctgcccaaacacggtcga
ggtattgtttgtccgctcatcgagattgaagtttgcggagcagaatatgacaatgccaag
cagaggacagactcagaagcagacaatggtctgaaccccacctggaccaggaaactcttt
aggttcaccgtgtgcaatccttccttcgcattcctgcgctttgtggtctacgaaatcgac
atgttcagtgaccagaactttctggcccaggccacattccccatcaactgcctcaaaaca
ggctaccgctcggtcccgctgaagaacagctacagtgaggatctggagctggcctgtctg
ctggtgcacatggacgtcatcagaggacgggtgggatatgagatgatccatgagaatgga
gacatgttgagtccgttctctccggctggggcgatggcgatggctatgcagacgggccgc
gagcggatgaacgactctggctccgtctcctccacctcctccatgtctcctctgccctcg
tctccggcgcaggctctagggtaccgcgggcgcgagggctcgttcgaggcccgctatcag
acccctctggaggacttcagagtgtctcaggaggcgctgctggaccacgagaacaggagg
ctccgcagggctcgcgtcagcgccgataaccgagcgtaa

KEGG   Danio rerio (zebrafish): 561747
Entry
561747            CDS       T01004                                 

Gene name
plcg2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04370  VEGF signaling pathway
dre04625  C-type lectin receptor signaling pathway
Module
dre_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    561747 (plcg2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    561747 (plcg2)
   04370 VEGF signaling pathway
    561747 (plcg2)
   04020 Calcium signaling pathway
    561747 (plcg2)
   04070 Phosphatidylinositol signaling system
    561747 (plcg2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    561747 (plcg2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    561747 (plcg2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     561747 (plcg2)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    561747 (plcg2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    561747 (plcg2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_14 PH_12 PH_10
Other DBs
NCBI-GeneID: 561747
NCBI-ProteinID: NP_001038433
ZFIN: ZDB-GENE-030131-9532
Ensembl: ENSDARG00000068763
Vega: OTTDARG00000012465
UniProt: Q1LWV8
LinkDB
Position
18
AA seq 1240 aa
MAGRAHQGDLTEYKKSLIKRDLEMGIVMTVYRQRIERLTVQVIMETRQVAWSRTANKTEG
VLDIFEIREVRPGKNSKEFDRFKDHKDRNTDPNTCFTIFYGSQFVLNTLSLGADSVEDAE
KWLTGLELLRDETLAAHTPEIIESWLRKQMYSVDQTKKNSITMKELKSLLPQMNFKVPCG
RFLKDKFAALGAKKEVLDFEQFHKFYNSLIFENQKSILDEFKKETCAFILGNGDQPIQLS
DFQRFLLYQQRETWANNLNQVRELMTIFIDDTMRETNDPAFILEEFLSFLFSKENQIWDD
KFSEICPLDMNNPLSHYWINSSHNTYLTGDQLRSESSTEAYVRCLRLGCRCVELDCWNGP
EEPIIYHGWTRTSKIKFKDVVKAINDHAFATSEYPVVLSIEEHCDVKQQKMMAQVFKDVF
QDKILMEPLEPEAEQLPSPTQLKGKIIIKHKKLNIDQTFGRKDLRKGDKQGELFIWDPID
ERWYRHYCVIENKTLYYAEENDEEEEKSVQSCTELHQSEPWFHGRMSEGRMTAERLLQEY
CAESGGVDGTFLVRESDTFVNDCTLSFWRSGRVQHCRIRSCLEGGHTVYFLTENLHFPSV
YALIYYYRDNLLRCQDFNLRLTEYVPKPDTHQLEGWFYSNLSRGEAEDYLMRIPRDGAFL
IRQREDSDSYAITFRGEGLVKHCRIHKDGSMYILGTSSEFDSLVELVDYFRKKPLYRKTK
LRYPVTPELVERFSSINKTGSLYDSKQYVEANEIEPSLPQNTVKALYDYRAMRPDELTFS
KGVLIHNVTRDTNGWWKGDYGGKLQHYFPSNYVEEVQSDANYQPEEENPLGELCKGTVDI
SKCTVVRSAKHGKQVVVTLQYKEDKENMMPFDLATETTEELYEWYQVAWDITQREENLVF
EKEKTKEVETRDEVASEMSELVVYCQPRSKEKDGFDNYTYKEVRSFVENKTPSRNKLTQF
MLYNRKALSRIYPKGQRVDSSNYDPYPLWMCGCHMVALNFQTADKYTQLNSALFSLNGST
GYVLQPELMRRDSYDPQQERKNIKYTIGIRVIGARHLPKPGRSIASPFVEIELCGQTDES
KFKTTVCHDNGLNPIWQPSEMFVFSVYEPDLTFLRFVVFEEDMFSDPNFLAQATFPVKGV
RSGYRSVPLKNGFSENLELASLLVCVDVQQVEKAQEELYSSSKQLQKKQAEMSSEFCLYD
THSNLRSSGPQRREDLSQFTYSEKKINKPQQKINNSKFYS
NT seq 3723 nt   +upstreamnt  +downstreamnt
atggcgggtcgtgctcatcagggagacctgaccgagtacaagaagagcctcatcaagcgg
gacttggagatggggatagtgatgacggtgtacaggcagaggattgagagactcacggtg
caggtcattatggagacgcggcaggtggcctggtcacgcaccgccaacaagactgaagga
gtgttggacatttttgaaatccgggaagtacgaccaggaaaaaactccaaagaatttgat
cgcttcaaggaccacaaagatagaaatacagacccaaacacatgctttaccatattctac
ggctctcagtttgttctcaacactctcagtctgggagctgattcggtggaagatgcagaa
aaatggctgacaggattggagttactcagagatgagacactggcagctcacacaccagag
attatagagagttggctgaggaaacagatgtattcagttgatcagacgaagaaaaacagc
atcaccatgaaagagctgaagtcccttttgccacagatgaactttaaagtaccttgtgga
cgctttttgaaggacaaatttgcggcattgggagcaaagaaggaggtcctggattttgag
caatttcacaaattttacaattctttgatatttgagaaccaaaagtcgattttagatgag
tttaaaaaggagacgtgtgctttcatcctgggtaatggtgatcagcctattcaactcagt
gatttccaaaggttccttttatatcagcaaagagagacttgggctaacaatctgaatcaa
gtccgagagttaatgaccatcttcatcgacgacaccatgagggaaaccaatgatcctgca
tttatccttgaagagttcctcagttttctcttctccaaagaaaaccaaatttgggatgac
aagttttccgagatttgcccactggacatgaacaatcctctgtctcactactggatcaac
tcgtctcacaacacatatttaactggagatcagctgcgtagtgagtcttcaacagaagcg
tatgtgcgctgtctgaggctgggctgtcgctgtgttgaattggactgctggaatggtcca
gaggaacctattatatatcacggctggaccagaacctccaagataaagtttaaagatgtg
gtgaaggccatcaatgatcacgctttcgcaacatctgagtatcctgtggtgctgtccata
gaagaacactgtgacgtcaagcaacagaaaatgatggctcaggtgttcaaagatgttttc
caggacaaaatcctgatggaacctctggaaccagaagcagaacaactgccatcaccaacc
cagctcaagggcaagatcatcattaagcacaaaaaactgaacatcgatcagacctttggc
agaaaggaccttcgaaaaggagataagcaaggagagctcttcatctgggatccaatagat
gagaggtggtacaggcactactgtgtgattgagaataaaacgctctattatgcggaggag
aatgatgaagaggaagaaaagtcggtccagtcttgcacggagcttcatcagtctgagccg
tggtttcatggccggatgtccgagggccgaatgactgcagaaagactgctgcaggaatac
tgtgctgaatcgggtggagttgatggaacatttctggttcgggagagtgacaccttcgta
aatgattgcacactttcattctggcgcagtggacgagttcagcattgtcgaatccgttcc
tgcttggaaggaggacacacagtttatttcctgacagaaaacctgcacttccccagcgtg
tatgctctcatctattattacagagacaacctgctccgctgtcaggatttcaacctgcgc
ctcactgaatatgtgcctaaaccagacacgcaccagttggaagggtggttttacagtaac
ttgagtcggggtgaggcggaggactatctaatgcggatccctcgagacggagccttcctc
atcagacagagagaggattcagactcgtatgccatcacattcagaggcgaaggcttggtg
aagcactgccggatacacaaagacggctctatgtacattctgggcacttctagtgagttt
gacagcctggtggaactagtggactatttccgaaagaagccgctgtatcgaaaaacaaaa
ctgcgctatcctgttacaccagaactagtagagcgcttcagttcgataaacaaaacaggt
tcgctgtatgactctaagcagtatgttgaggctaacgagatcgagccgtctctgccccag
aacacagtgaaggctctttatgactacagggcaatgcgtcctgatgagctcaccttttca
aaaggtgttttgatccataatgtgaccagggacacaaatggatggtggaaaggagactat
ggtggaaaactccagcactatttcccttcaaattacgtagaagaagtccaatctgatgcc
aattaccagcccgaagaggaaaatccattaggtgaattgtgtaaaggcacagtggacatc
tcaaagtgcactgttgttcgctctgccaaacatggcaaacaagtggtggtaactctgcag
tataaggaggataaagagaacatgatgccatttgatttggccaccgagaccactgaagag
ctgtacgagtggtatcaggtggcctgggacattacgcagagagaggaaaacctagtgttt
gagaaagaaaaaacgaaggaagtggagaccagagatgaagtggccagtgagatgtcagaa
ctggttgtttactgccagccacgcagcaaagaaaaggacggctttgataattatacctac
aaagaagtccgctccttcgtagagaataagacgccctccagaaacaagctgactcagttc
atgttgtataaccgcaaggctttgagccgcatctatcctaaaggccagcgggtggattcc
tccaactatgacccgtatccgctgtggatgtgtggctgtcacatggtagcgctcaacttc
cagacggctgataagtacactcagctgaacagcgccctcttcagtctaaatggaagcaca
ggatatgtactgcaacctgagctgatgcgcagagattcatatgaccctcaacaggagagg
aagaacatcaaatatactatcggaatcagagtgattggagcacggcatcttcccaaacca
ggacgaagtattgccagcccctttgtggagattgagctgtgtggtcaaacagatgagagc
aaattcaagactaccgtttgccatgacaatgggctgaaccctatatggcagccttcagag
atgtttgttttcagcgtgtatgagccggacctcacctttctacgctttgtggtctttgaa
gaggacatgttctctgacccaaatttccttgcccaggctacattcccagtgaaaggtgtc
cgctcaggctacagatcggttcctttaaagaatggcttcagtgaaaatctggagctggca
tctctactggtctgtgttgatgtacagcaggtggagaaagcacaggaggaactttactcc
tcctcgaaacagttgcaaaagaagcaggcggagatgagcagcgagttctgcctttacgac
actcactccaacctgcgctccagtggccctcaacgccgcgaagacctctcgcagttcact
tactctgaaaaaaagataaataaaccacagcaaaagataaacaacagcaagttctactcg
tga

DBGET integrated database retrieval system