KEGG   Danio rerio (zebrafish): 378478
Entry
378478            CDS       T01004                                 

Gene name
egfra
Definition
(RefSeq) epidermal growth factor receptor precursor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04068  FoxO signaling pathway
dre04144  Endocytosis
dre04510  Focal adhesion
dre04520  Adherens junction
dre04540  Gap junction
dre04810  Regulation of actin cytoskeleton
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    378478 (egfra)
   04012 ErbB signaling pathway
    378478 (egfra)
   04068 FoxO signaling pathway
    378478 (egfra)
   04020 Calcium signaling pathway
    378478 (egfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    378478 (egfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    378478 (egfra)
   04520 Adherens junction
    378478 (egfra)
   04540 Gap junction
    378478 (egfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    378478 (egfra)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    378478 (egfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    378478 (egfra)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    378478 (egfra)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     378478 (egfra)
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   378478 (egfra)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   378478 (egfra)
  Exosomal proteins of pancreatic cancer cells
   378478 (egfra)
  Exosomal proteins of bladder cancer cells
   378478 (egfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 378478
NCBI-ProteinID: NP_919405
ZFIN: ZDB-GENE-030918-1
Ensembl: ENSDARG00000013847
UniProt: Q7SZF7
LinkDB
Position
2
AA seq 1191 aa
MAGPTEIGLFFTLLLSGSFCATPEKKVCQGANNKLTLLGTVEDHYQVLLRMYRNCTVVLE
NLEITHITEKYDLSFLKSIQEVGGYVLIAVNTVSKIPLENLRIIRGHSLYEDKFALAVLV
NFNNSIEQGVKELPLTSLTEILKGGVKFCRNDYLCNVGTIEWADILNMKSLPTIVSHNIS
YGKNCGKCDPSCFNGSCWGTGPDKCQRMTKVICAEQCSGRCKGPRPIDCCNEHCAAGCTG
PRPTDCLACKDFQDEGTCKDACPRLMLYDPNTHQLAPNPYGKYSFGATCIKTCPHNYVVT
DHGACVRTCSPGTYEVDEGGVRKCKRCEGLCPKVCNGLGMGPLANVLSINATNIDSFENC
TKISGNVAILSTTFRGDPHTNTSGLDPAKLSVLSTVKEITGYLMIQLWPESMQSLSAFEN
LEVIRGRTKTQGTYSFAVTKTAITHLGMRSLREISDGDVSIVKNKNLCYSSPEHWKRLFK
SKQQSVKMIENMDAATCANQNSTCNEMCTADGCWGPGPTMCFGCEHYSRGKHCVASCNLL
NGEPREYEVNKTCMECDPECLLMNETQTCNGPGPDKCTVCANYKDGPHCVHRCPQGVPGE
KDTLIWKYADVTHVCQPCHENCTQGCTGPDLKDCKDFKSSGLPMIAAGVVGGLLAFVILA
LGVAVLLRRRHIRRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGSG
AFGTVHKGLWVPEGENVKIPVAIKVLREATSPKANKEIMDEAYVMASVEHPHVCRLLGIC
LTSTVQLITQLMPYGCLLDYVRENKDRIGSQHLLNWCVQIAKGMNYLEERHLVHRDLAAR
NVLVKTPQHVKITDFGLAKLLNADEKEYHADGGKVPIKWMALESIQHRTYTHQSDVWSYG
VTVWELMTFGTKPYDGIPASEIAGVLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRF
RELIAEFTKMARDPSRYLVIQGDDRMHLPSPSDSKFYRSLMSGELDEAVDADEYLVPNHS
FFSSPSTSRTQLLHSVSLNSSFGNCNSRNGNGYPVRENSMVLRYIPDPTERFQEGDFQPA
PGYNEYMNQNESSMINPVYQQPHGPPRTLLHSSPALDETEEEYLNCFKSPAPASVVEYLN
TSHTQLLSTKPFFSMDNPDYQQDFCPLELKTHTNGHLPAAQNQEYMGLEVH
NT seq 3576 nt   +upstreamnt  +downstreamnt
atggcaggaccaactgaaatcggattgttttttaccttattgctctccgggagcttctgc
gcgacgccggaaaagaaagtgtgtcagggagcaaacaacaaactgactcttctgggaacg
gtggaagaccattatcaggttctgctcagaatgtacagaaactgcactgtggttctggag
aacctggaaattacacatataacagagaaatatgacctgtccttcctcaagagcatccag
gaagttggtggctatgttcttatcgcggtcaatacggtttccaaaatccctctggagaac
ctgcgcatcattcgcggacactcactttatgaagacaaatttgccttggccgtcctggtg
aacttcaacaacagcatcgaacaaggcgtaaaagagttgccgctgactagtttaactgaa
atacttaagggtggagtcaagttttgcaggaacgattatttatgtaatgtggggaccatc
gagtgggccgacatcctgaacatgaagagcctgcctacaatcgtgagccataatataagc
tatggaaaaaactgtggaaagtgcgatccaagctgtttcaatggctcctgctggggcacc
ggacccgacaagtgccagagaatgacgaaagtgatctgtgcggagcagtgttcagggagg
tgtaaaggacccagacccattgactgctgtaatgaacactgtgctgctggatgcactgga
cccagacctacagactgtctggcctgtaaggacttccaggatgaagggacatgtaaggac
gcatgtccgcggctcatgctctacgacccaaacacacaccagctcgcgccaaacccatat
gggaagtacagctttggggcaacgtgcatcaagacatgcccacacaactatgtggtgacg
gatcacggggcctgtgtgagaacatgcagccctggcacctatgaagtggatgagggtgga
gttcgcaaatgtaagaggtgtgaaggcctgtgtccaaaagtgtgcaatgggttgggaatg
gggcctttagccaatgtcctgtcaatcaatgccaccaacatcgactcctttgagaactgc
actaaaatcagcggcaatgttgccatcctcagcaccacattcagaggtgacccacatact
aacacttcaggactggatccagcaaagctcagtgtattgagtactgtcaaagaaatcact
ggttacctgatgattcagctgtggccggagagcatgcagtcccttagtgccttcgaaaac
cttgaggtcatccgaggacggacaaaaacacaaggaacgtacagctttgctgtcaccaag
acggccatcactcatttaggcatgcgttctctgagggagatcagtgacggggacgtgtcc
atcgttaagaataagaatctctgctacagcagccctgaacactggaaacgcctcttcaag
tccaaacaacagtcggtcaaaatgattgaaaatatggatgctgccacctgcgccaatcag
aacagcacatgtaatgagatgtgcacggctgacggctgctggggtcccggccccaccatg
tgcttcggctgtgagcattacagccgcggaaaacactgcgtggcttcctgcaacctgctg
aatggtgagccgcgtgaatatgaggtcaataaaacatgcatggaatgcgatcctgaatgt
ctgctcatgaatgaaacccagacctgcaacggccctggacccgacaaatgtacagtgtgt
gcaaactataaagacggaccgcactgtgtgcatcgctgcccgcaaggtgtaccaggagag
aaagacacactcatctggaaatacgctgacgtgacacacgtttgccagccctgtcatgaa
aactgcacccagggatgtacggggcctgatctaaaggactgcaaagatttcaaaagctct
ggtttgccgatgatcgctgctggcgttgtcggaggtctactggcgtttgttattctggct
cttggagtggccgttctcctgcgcagacgccacatccggaggaagaggactctgagacga
ctcctgcaagagagagagcttgtggagcctctgacccccagcggcgaagcccccaatcag
gccttactgcgcatcctcaaagagacggagttcaagaagatcaaagtgctgggctccggg
gctttcggcactgtgcacaagggcctttgggttccagaaggagagaatgtgaagatccct
gtcgccatcaaggtcttaagagaagccacgtctcccaaagctaacaaggagataatggat
gaggcgtacgtcatggccagtgttgagcatccccatgtgtgtcgtctgctgggcatctgc
ttgacctccacagtgcagctcatcactcagctgatgccctacggctgcttgctggactat
gtcagagaaaacaaggaccgcatcggctcccagcacctgctcaactggtgcgtgcagatc
gctaaaggtatgaattatctagaagagcgccatcttgtgcaccgagacctggcagcacgt
aatgtgttggtaaagacgcctcagcatgtcaagattaccgatttcggcctcgccaagctg
ttaaacgcggacgagaaggagtatcacgcagatggaggaaaggttccaattaaatggatg
gcgctggagtccatccagcacaggacttacacccaccagagtgacgtctggagctacggt
gtgaccgtctgggagttgatgacgtttgggacgaaaccttatgatgggattcctgccagt
gaaatcgccggagttctggaaaaaggagaaagacttcctcaaccccccatctgcaccatt
gatgtgtacatgatcatggtcaaatgttggatgattgatgctgagagcagaccccgcttc
agggagctcatcgcagagttcactaaaatggctcgtgacccgtcccgctatctggtcatt
cagggggacgaccgcatgcatttacccagtccttctgactccaagttctaccgcagcctg
atgagcggagagctggacgaggccgtggacgcagacgagtatttagtgcccaatcacagc
ttcttcagcagcccgagcacgtcccgcacacaactgctgcactctgtgagcctgaacagc
agctttggaaactgtaatagtagaaacgggaatggttatccagtgagggagaacagcatg
gtcctgcgctacatcccagaccccacagagcgctttcaggagggagactttcagcctgcg
ccgggttataacgaatatatgaaccagaatgagtccagcatgatcaacccagtgtaccag
cagccccacggacccccgcggaccctcctccactcctccccagcgctggacgagacggaa
gaggagtatctgaactgcttcaagagcccggctccggcttcagtggtggagtatctgaac
acgtcccacacacagctgctctccacaaagcccttcttcagcatggacaaccccgactac
cagcaggacttctgcccgctggagctcaaaacacacaccaacgggcacctgccggccgcg
cagaaccaggagtacatgggcctggaggtgcactag

KEGG   Danio rerio (zebrafish): 571431
Entry
571431            CDS       T01004                                 

Definition
(RefSeq) epidermal growth factor receptor-like
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04068  FoxO signaling pathway
dre04144  Endocytosis
dre04510  Focal adhesion
dre04520  Adherens junction
dre04540  Gap junction
dre04810  Regulation of actin cytoskeleton
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    571431
   04012 ErbB signaling pathway
    571431
   04068 FoxO signaling pathway
    571431
   04020 Calcium signaling pathway
    571431
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    571431
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    571431
   04520 Adherens junction
    571431
   04540 Gap junction
    571431
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    571431
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    571431
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    571431
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    571431
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     571431
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   571431
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   571431
  Exosomal proteins of pancreatic cancer cells
   571431
  Exosomal proteins of bladder cancer cells
   571431
SSDB
Motif
Pfam: Recep_L_domain GF_recep_IV Furin-like
Other DBs
NCBI-GeneID: 571431
NCBI-ProteinID: XP_700110
LinkDB
Position
24
AA seq 662 aa
MRFTKLSLFCELGIICLVLINAGWCAVFERKVCQGTNFKLAPLGHPDDHYRAMVRMYSNC
TVVLENLEITYVQEYHDLSFLKSIEEVRGYVLIGVNNIDVIPLENLRLIRGHSLFEDRYA
LNVLLNNNRNESSKNTNGLRELRLRSLTEILKGGVKIVHNPFLCNVETIQWLDIVEHGSY
VHVSREIGAQCRPCDSGCYSGSCWAPGPENCQTLTRLSCAEQCSRRCKGPKPIDCCNEHC
AAGCTGPQPTDCLACRDFQDDGACKDSCPPLMLYDPINYQLVPNPNGKYSFGDTCVKQCP
HNFVVTDNACVRSCGSNMQEVEENGIITCKKCEGLCPKVCNGLGTGELVNTIAVNATNID
SFINCTKINGHITIMQMTFKGDVHTNTPSMDPAKLDYFKTVKEISGYLLIRDWPKHLKSL
SAFENLEIIRGRTKLQSTIGFAALNIPHLEHLGLRSLKEISDGDVVVRNNPQLCYTDGSY
WTKLFRSEQQRIRTGNNAAPHICVQQNSTCDSMCGDEGCWGPGPSMCVFCQHVSRRGCCV
SHCNLLNGDPREYMSDNVCLACDPQCKALNGTASCHGPGADQCTECAHFKDGTHCVAQCA
HKVQGPNNRLVWMYPDKSRQCQPCHANCTHGCSGPGLHGCEPKGSCLCPVDQSANDNEQL
SS
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgaggtttacgaagctgtctctgttctgtgaattgggaatcatatgccttgtgctgatc
aacgcagggtggtgcgccgtttttgagaggaaagtatgccagggaaccaattttaagctg
gctcctctgggtcatccggacgatcactacagagccatggtgcgcatgtacagtaactgt
acagtagtgttagagaacctggagatcacctatgttcaggagtaccacgacctgtccttc
cttaagagcattgaagaagtccgcggctacgtgctaattggagtaaacaacatcgatgtg
atacccttggaaaaccttcggctcattcgaggacattctctctttgaggacagatacgcc
ctcaatgtattgttaaacaacaacagaaatgagtcctcaaaaaacaccaacggcctcaga
gagctgcgtttgagaagtctcacagaaattcttaaaggtggagttaaaatagtccacaat
ccttttctttgcaatgtggagaccatacagtggttggacattgtggagcacggcagctat
gtgcacgtgtcacgagaaattggtgctcagtgcagaccgtgtgattcaggctgctatagt
ggatcatgttgggctccaggaccggagaactgccagaccttgacgcggctgagctgtgct
gagcagtgctcgcggaggtgtaagggccccaaacccatcgactgctgcaatgaacattgc
gctgccggctgcactggaccccagcccacagactgcctggcctgcagagatttccaagac
gatggggcatgcaaggactcatgtccacctctaatgctgtatgatcccattaactaccaa
ctcgttcccaatcctaacgggaagtacagcttcggagacacctgtgtgaagcagtgccct
cataactttgtagtgactgataatgcctgtgtccgatcctgtggcagtaacatgcaagaa
gtggaagaaaacggcatcataacgtgcaaaaaatgcgaaggcttgtgcccaaaagtgtgt
aatggtctcgggacaggagagcttgtaaacaccattgcagtcaatgcaaccaacatcgat
tcattcatcaactgcactaaaataaacgggcacattacaataatgcagatgacttttaaa
ggggatgttcacacaaatactccaagcatggaccctgccaaacttgactatttcaagacg
gtgaaggaaatttcaggctatctattgatcagagactggccaaaacacctcaaatccctc
agtgcctttgagaacctggagatcatcagaggaagaaccaaactacaaagcaccatcggt
tttgcagctctgaatattcctcacctggagcatctgggtttgcgttcactgaaggagatc
agtgacggagatgtggtggttaggaacaatcctcagctgtgttacacagacggcagctac
tggacgaagctcttcagatctgagcaacagcgcatacgcactggaaacaacgcagcaccg
cacatctgtgtacagcagaacagcacctgtgacagtatgtgtggagatgaaggctgttgg
ggtccggggccgtccatgtgtgtgttctgtcagcacgtcagccgtaggggatgctgtgtc
agtcactgcaacctgctgaacggagaccctcgagagtacatgtcagataatgtgtgtttg
gcttgtgacccacaatgcaaggctctgaacgggacggcaagttgtcatgggccgggtgct
gatcagtgtacagagtgtgctcactttaaagatgggacacactgcgtggcacaatgtgcg
cacaaagtgcaaggccctaataacagactagtctggatgtacccagacaaaagcagacag
tgccagccatgccatgctaactgtacacacgggtgtagtggaccaggactgcatggctgt
gaaccgaaaggatcttgcctttgccctgtggatcaatcagcaaatgataacgagcagctt
tcgtcatga

DBGET integrated database retrieval system