KEGG   Danio rerio (zebrafish): 386856
Entry
386856            CDS       T01004                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04020  Calcium signaling pathway
dre04144  Endocytosis
dre04510  Focal adhesion
dre04540  Gap junction
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    386856 (pdgfra)
   04020 Calcium signaling pathway
    386856 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    386856 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    386856 (pdgfra)
   04540 Gap junction
    386856 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    386856 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    386856 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dre04090]
    386856 (pdgfra)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     386856 (pdgfra)
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   386856 (pdgfra)
CD molecules [BR:dre04090]
 Proteins
  386856 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 386856
NCBI-ProteinID: NP_571534
ZFIN: ZDB-GENE-990415-208
Ensembl: ENSDARG00000070494
UniProt: Q9DE49
LinkDB
Position
20
AA seq 1059 aa
MFPVLPQSVQAPLIWPQRESMEVSLHSTFRLTCRGQTELSWNGPVFIDDQTNSVKKGLFI
STVTISNATAVHTGEYVCSSEPFNSTESTIYIYVPDPQTPFVPSMTPFENHVLTSYDEME
IPCRVTDPSASVSLIHMGTDQVMPSAYDSKRGFIGLFGAGTYVCRALIHGQNHDSIEYIV
HGWTGGSDLRVELRAVKRTLLVGETITVDCVAKGSEVLEDHWKYPGKLANRGPKTVKENK
LNLEIYYTLTVTNASPKDSGIYACSITDIMSNESQTKELTITVYDHEFVHINPLIGPVET
ARLDEVPEFKVDIESFPAPKVTWLKDSSVLGDDTAEISTTLLKIGETSYQGVLNLIRAKA
EDSGNYTVKAEIGSISTSYSFYLQVKVPPVIVDLIDVHHGSAAGQEVVCTAGGSPFPEVD
WDICKNLKHCANDSSQWMPLPINSTDITVELQMNVDNHIESHIIFHHLEGTVAVRCLARN
DMGVVSREVKLMSSGPHSELTVAAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESV
SPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVA
VKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNY
LHKNRDGFLSRHTEKGKKDLDIFGINPADESSRSYVILSLEGKGDYMDMKQADTMQYVPM
LEMNEASKYSPIQRSDYDHPPSHRQFNDEAESLLSDDSAEGLTTMDLLSFTYQVARGMEF
LASKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIF
DNLYTTLSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMTKPEHASSDVYEL
MMKCWNSEPEKRPSFHSLSDTVASLLPSGFKRCYERVNHDFLKSDHPAVTRVQCIDNDDA
YMGVLYKNQGKMKTRESGFDEQRLSSDSGYIIPLPDLDPLSNEDYSKRNRHSSQTSEESA
IDTGSSSSTTKREGETLEDITLLDEMCLDSGDLVEDSFL
NT seq 3180 nt   +upstreamnt  +downstreamnt
atgttcccggtgctgccacagtcagttcaggctccactgatttggccccagagggagagt
atggaggtgtctctgcactccactttcagactcacatgtcgaggtcaaaccgagctctcc
tggaatggccctgtttttattgatgaccagaccaacagtgtaaagaaaggactctttatt
agcactgtgacaattagcaatgccacagctgtccatacaggagagtacgtctgctcttct
gaacccttcaacagcactgagtccaccatctacatttatgtgccagatccacaaacccca
tttgtgccgtccatgaccccgtttgaaaaccacgtgctgacgagttatgatgaaatggag
attccctgccgtgtgacggatcccagtgccagcgtctctctcatccacatggggaccgat
caagttatgcccagcgcctacgacagcaagagaggattcatcgggctcttcggcgctggg
acgtatgtctgccgagccctcattcatggacagaatcatgacagcattgagtacattgtt
catggatggacaggagggtctgatttgcgagtggagctgcgggcagtgaagagaactctg
ctggtgggtgagactatcactgttgactgtgtagccaaaggcagtgaggtgctggaggac
cactggaaataccctggcaaactggctaatcgtggtccaaagactgtaaaggagaataag
ctaaatctggagatctattatactctgacagtgactaatgcctcaccaaaagacagcggc
atctatgcctgctccatcactgacatcatgagcaacgagagccaaaccaaagagctgact
attactgtctatgatcatgaatttgtccacatcaatccattgatcggtccagtggaaact
gccaggctggacgaggtgccagagtttaaagtagacatagagtctttccctgcacccaaa
gttacatggttaaaggacagttctgtcttgggagatgatactgcagagatcagcaccacc
ctcctcaaaatcggcgagaccagttaccagggtgtgttgaacctgatcagagctaaagca
gaggacagtggaaactacaccgtcaaggcagaaataggcagcataagtaccagctacagt
ttctaccttcaggttaaagttccccctgtgattgtggacctgatcgacgtccatcatggt
tctgctgcgggtcaggaagtggtatgcactgctggcggctccccattccctgaagtggac
tgggatatctgcaaaaaccttaaacactgtgccaatgattcctcccagtggatgccactt
ccgatcaactcgacggacatcacagtggaactgcaaatgaatgtggacaaccacattgag
agccacattattttccaccatcttgagggcacagtcgctgtgcgctgtctggccaggaat
gacatgggtgttgtttcacgggaggttaaactcatgtcaagtggtccgcattcggagctc
actgtggctgctgcggttctggtgctgctggtcattgtcatcatctcactcattgtgctg
gtcattatatggaaacagaaaccacgttatgagattagatggcgcgtgattgaatcagtc
agtccggatgggcacgagtacatctatgtcgatcccatgcagcttccatatgattcccgc
tgggagttccctcgggatggactcgttctgggtcgcgtcctgggttcaggagcttttggt
aaagtggtggagggtactgcttatggactaagccgttctcagcctgtgatgaaagttgct
gtgaaaatgcttaagccgaccgcccgttccagtgagaaacaagctttgatgtcagagctg
aaaatcatgacccatctgggccctcacctaaacattgttaaccttctgggagcgtgtacc
aaatcaggaccaatctacattataacagagtattgtttctatggagatctggtgaattac
cttcataagaacagagatgggtttctcagccggcacacagaaaagggaaagaaagatcta
gacatctttggcatcaacccagccgatgagagcagcaggagctatgtcatcctgtctctc
gaggggaaaggtgattatatggacatgaagcaggcagacaccatgcagtacgtccccatg
ctggaaatgaatgaagcctcaaaatactctcccatccagagatcagactacgatcatcct
ccctctcacagacaattcaatgatgaagcagagagtcttctatcagatgacagcgctgaa
ggcctgaccacgatggacctcctcagtttcacctatcaagtggctcgagggatggagttt
ttggcctctaagaattgtgtgcaccgagacttggctgcacgaaatgtcctgctgtctcaa
ggcaagatagtgaagatctgtgactttgggctggcaagagacatcatgcacgataacaac
tatgtctccaaaggaagcacgtttcttccagtgaagtggatggctcctgaaagtattttt
gataatctctacacaacgctgagtgatgtctggtcttatggcatcttattatgggagatc
ttctctctcggagggacgccttatcccggcatggttgtggattccagcttctacaacaag
atcaagagtggataccgaatgaccaaacctgagcatgcgtccagtgatgtctatgagctc
atgatgaagtgctggaacagtgaaccggagaagagaccatctttccacagtctgagtgat
acagtggcatctctgctgccctcaggatttaagaggtgttatgaacgtgtgaatcatgac
ttcctgaagagcgatcaccctgctgtgactcgggtgcagtgcattgacaatgacgatgcc
tacatgggtgtgctctacaaaaaccagggcaaaatgaagacccgtgagagtggctttgat
gaacagagactcagctctgacagcggctacatcattcctctgccagacctggatccactt
tctaacgaagactacagcaagaggaaccgccacagctctcagacatcggaggaaagcgcg
atagatacaggctctagcagctccacgaccaagcgtgagggagagactctggaggacatc
accttgctggacgagatgtgcttggactcaggagacctggtggaggacagcttcctgtga

DBGET integrated database retrieval system