KEGG   Danio rerio (zebrafish): 386966
Entry
386966            CDS       T01004                                 

Gene name
erbb2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 precursor
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04510  Focal adhesion
dre04520  Adherens junction
dre04530  Tight junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    386966 (erbb2)
   04012 ErbB signaling pathway
    386966 (erbb2)
   04020 Calcium signaling pathway
    386966 (erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    386966 (erbb2)
   04520 Adherens junction
    386966 (erbb2)
   04530 Tight junction
    386966 (erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    386966 (erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    386966 (erbb2)
   04090 CD molecules [BR:dre04090]
    386966 (erbb2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     386966 (erbb2)
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   386966 (erbb2)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   386966 (erbb2)
CD molecules [BR:dre04090]
 Proteins
  386966 (erbb2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH EphA2_TM
Other DBs
NCBI-GeneID: 386966
NCBI-ProteinID: NP_956413
ZFIN: ZDB-GENE-031118-121
Ensembl: ENSDARG00000026294
Vega: OTTDARG00000020518
UniProt: Q5EBY4
LinkDB
Position
12
AA seq 1275 aa
MEADRSFGLAWVLLLLLGITAATGREVCLGTDMKLALPSSLENHYEMLRLLYTGCQVVHG
NLEITHLQGNPDLSFLQEIVEVQGYVLIAHVSVRSLPLDNLRIIRGSQLYKSNYALAVHN
NSNSSQAGLGLRELRLRSLTEILLGGVYIWGNPQLCFPRNINWEDTVSKVQNKPLHLQDI
PKNCPRCSSACKSGGCWGEKDQDCQTLTSVNCSSGCSRCKGPKPSDCCHVQCAAGCTGPK
DSDCLACRHFNDSGTCKDSCPPPTIYDPITFQSKPNKDKKFSFGATCVKQCPHNYLAMEV
ACTMVCPKANKEVISVEPDGQETQKCEKCEGECPKVCYGLGMGNLQGVSVVNSTNIGMFT
GCEKIYGSLAFLSDSFKGNADTNSSGLQPSDLEKLKTIEEITGYLYIDAWSENLLDLSVF
ENLKVIRGQMLYKGVFSLGVQSLQIESLGLRSLRSVSGGLVLIHNNSRLCYTSSLPWTSL
LHPTQGPNLISNNNKDQQTCVSEGKICDPLCGDSGCWGPGPSQCVSCLNYKRGTECVELC
NVLHGSVREFEDGFNCVPCHPECRPINGTASCTGPGPDQCTDCMHFQDGDVCVERCPSGV
KEEQHTVWKYSNATGHCLPCETNCTVSCPLDDRGCPIQQKTGPGTTVAITVGGVLLFIIL
LALLVFYLRRQKHQKKKETIRRRLQEHELVEPLTPSGAMPNQAQMRILKETELKKLRVLG
SGAFGTVFKGIWAPDGENVRIPVAIKVLRENTSPKANKEILDEAYVMAGVASPYVCRLLG
ICLTSTVQLVTQLMPYGCLLDYVRENKDRIGSQYLLSWCVQIAKGMSYLEEVRLVHRDLA
ARNVLVKNPNHVKITDFGLARLLDIDEKEYHADGGKVPIKWMALESILHRKFTHQSDVWS
YGVTVWELMTFGMKPYESFQARDIPELLEAGERLSQPCNCTKEVYMIMVKCWQIDPDNRP
RFKDLVDEFTTMARDPSRYVVIQNEDQMSLSSPVDSEFFRILMAEEGGNVKEFLDAEEYL
VPQPGSIFNTHGEMRANGPSRHHSHRSTDQMVEVDGLPNGRELYSSVSMIEQSQYPTLPV
GATANGMWPGTQYPPLARSISHRSAGGQSDSVFLDGYVEDSCPPSSPCRYSKDPTMPNGI
DGDLETDGNMVFLSHTLPRGTHTQPEYVNQDMASERPSTLPRKASERRFILNGLSTGNSV
ENPEYLVPIGSITPTSPAFDNPYYHDIAAKAQAVARVAINGGTNHRQPNGFMTPTAENPE
YLGLADTWSGHKEYT
NT seq 3828 nt   +upstreamnt  +downstreamnt
atggaggcggacagaagttttgggctcgcctgggtcctcctgctgctgttgggcattaca
gccgccacagggagagaagtatgtctcgggaccgatatgaaactggctttaccctccagt
ctggaaaatcattatgaaatgctcaggctgctctacacaggctgtcaggtggttcatggt
aacctggagatcacacacctgcagggcaatccagacctctctttcctgcaggagatagtg
gaggttcaggggtatgtgctgatagctcacgtctccgtacgctcccttccactggacaat
ctgcggattatacgaggcagtcagctttataaatccaactatgctctcgctgtacacaac
aacagcaacagcagtcaggctggactcggcctgagagaacttcgcctcaggagtctaaca
gaaatcctgcttggtggggtttatatttggggaaatccccagctttgctttcctcggaac
attaactgggaagacacagttagtaaagttcaaaacaaaccactgcacctgcaagacatt
ccaaaaaactgtcctcgttgctcttcagcttgtaaatctggtggatgttggggagaaaaa
gatcaggactgccaaacattgacgtctgtgaactgctcatctggctgttcgcgctgtaag
ggcccgaaacccagtgactgctgccatgttcagtgtgctgctgggtgtactgggcccaaa
gactccgattgtctggcctgtcgacacttcaatgacagcgggacatgtaaagacagctgt
ccaccgcccactatctacgacccaatcaccttccagtccaaacccaacaaagacaaaaag
ttcagcttcggagccacctgtgttaaacagtgtccccataactacctggcaatggaagtg
gcatgcacaatggtctgtcccaaagccaacaaggaagtcatatctgtggagccagacggc
caagaaacacagaaatgtgaaaagtgtgaaggagagtgtccaaaagtgtgttatggtctg
ggaatgggaaacctgcagggagtttcagtggtgaattcaaccaacatcggcatgttcacc
ggctgcgagaagatctacggcagtttggcttttctttcagactccttcaaaggaaatgca
gacaccaattcatccggcctgcaacccagcgatctggagaagttgaagacgatagaagaa
atcacaggatatctgtacatagatgcatggtcagaaaacttgcttgatctgagtgttttt
gaaaacctgaaggtgatcagaggacagatgctttacaagggtgttttctctttgggagtt
cagtctctgcagatcgagtcgctgggattgcgttctttacggagtgtcagtggaggttta
gtgctgattcataataactccagactgtgttacacctcctctctgccctggacttcactg
ctccacccaacacaaggaccaaacctcatcagcaacaacaacaaagaccagcaaacatgt
gtttcagaggggaaaatatgtgaccccttgtgtggggattcaggttgttggggtccagga
cccagtcaatgtgtgtcttgtctgaattacaaacgaggaactgagtgtgtggagctgtgt
aatgtcctacacgggtcagtgcgggagtttgaggatggatttaactgtgttccttgtcat
cccgagtgtcgaccaatcaatggcactgcctcctgtacaggcccaggtccagatcagtgt
acagactgtatgcactttcaagatggagacgtgtgtgtcgagcgctgtcccagtggagtc
aaagaggaacaacacactgtgtggaaatactccaatgctacgggacactgtctgccctgt
gagaccaactgtactgtctcgtgtccactggatgatagagggtgtcccattcaacagaaa
actgggcccggcacaacagttgcaatcacggtcggtggagtgcttctcttcatcattttg
ctggctctgctggtgttttacctacggcgacagaaacatcagaaaaagaaagaaaccata
aggagacgcctacaggagcacgagctggtggagccgctgaccccgagtggagcaatgcca
aaccaggctcagatgcggatccttaaggagacagagctgaagaagctcagagtgctcggc
tccggagccttcggcaccgtcttcaagggtatctgggctcctgatggggagaacgtgagg
atccctgtggccatcaaagttttacgtgagaacacctcacccaaagccaacaaagaaatc
ctggatgaggcttatgtgatggcaggtgtagcgagcccatatgtgtgccgtttgctggga
atctgtctgacatcaacggttcagctggttactcagctcatgccatacggatgcttgttg
gactacgtcagagagaacaaggaccgaattggctctcagtatctcctcagctggtgtgtt
cagattgcaaagggaatgagttaccttgaagaagtgaggctggttcacagagatcttgcg
gctaggaatgttctggtgaaaaacccaaaccatgtgaagattacagactttgggcttgcc
agattgctggacatcgatgagaaggagtaccacgctgatggaggaaaggtgccgatcaaa
tggatggcgctggagtctatattacaccggaagtttactcaccaaagtgacgtgtggagc
tacggggtgaccgtgtgggagctgatgacctttggcatgaagccctatgagagttttcaa
gcgcgggacattccagagctgctggaggccggggagcgactctcacagccgtgcaactgc
accaaagaagtctacatgatcatggtcaaatgttggcagatcgatcctgacaatcgaccg
agatttaaggacctggtggatgaattcaccaccatggcacgggatccctcacgttatgtt
gtcatccagaacgaagatcagatgagtctgtcgagtcctgttgatagcgagttcttccgc
atcctgatggcagaggagggcgggaatgtgaaggagtttctggatgcagaggaatacctg
gtaccacaacctggcagcatcttcaacacacatggagaaatgagagccaacgggccgagc
agacaccactcacaccggagtacagatcaaatggtagaggtggatggtttgcccaatggg
agagagttgtattcttctgtcagcatgatagaacagagtcaatacccaactcttcctgtg
ggcgcaacagccaatggcatgtggcctgggacacagtacccgcctctagcccggagcata
tcacaccgctcagctggaggccaatcagactctgtgtttctggacggttacgtggaggac
agctgccccccatccagcccttgtcgctattctaaagaccccaccatgcccaacggcatt
gatggagatctggagactgatggcaacatggttttcctgtctcacacactgccacgagga
acacacacgcaacctgagtatgtgaaccaggacatggcatcagagcggcccagcacactt
ccacgcaaggccagcgagaggagattcatcctcaatggcctcagcacagggaacagtgtg
gagaacccagaatatctggtgccaataggcagcatcacacccacctcgccagcattcgac
aacccctactaccacgatattgcagctaaagctcaggcagtggccagagtggccataaat
ggaggaacaaatcacaggcagcccaacggattcatgacgcccaccgcagaaaacccagag
tacctgggcctggcagacacatggagcggccacaaggagtacacctaa

DBGET integrated database retrieval system