KEGG   Danio rerio (zebrafish): 393733
Entry
393733            CDS       T01004                                 

Gene name
fgf1a
Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    393733 (fgf1a)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    393733 (fgf1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    393733 (fgf1a)
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    393733 (fgf1a)
Cytokines and growth factors [BR:dre04052]
 Growth factors
  Growth factors (RTK binding)
   393733 (fgf1a)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   393733 (fgf1a)
SSDB
Motif
Pfam: FGF Fascin DUF5753
Other DBs
NCBI-GeneID: 393733
NCBI-ProteinID: NP_957054
ZFIN: ZDB-GENE-040426-1729
Ensembl: ENSDARG00000017542
Vega: OTTDARG00000022491
UniProt: Q6PBT8
LinkDB
Position
14
AA seq 147 aa
MTEADIAVKSSPRDYKKLTRLYCMNGGFHLQILADGTVAGAADENTYSILRIKATSPGVV
VIEGSETGLYLSMNEHGKLYASSLVTDESYFLEKMEENHYNTYQSQKYGENWYVGIKKNG
KMKRGPRTHIGQKAIFFLPRQVEQEED
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaccgaggccgatattgcggtaaagtccagcccgcgcgactataaaaaactgacgcgg
ctgtactgtatgaatggaggatttcaccttcagatcctggcggacgggacagtggctgga
gcagcagacgaaaacacatacagcatactgcgcataaaagcaacaagtccaggagtggtg
gtgatcgaaggatcagaaacaggtctttacctctcgatgaatgaacatggcaagctgtac
gcttcatcattagtgacggatgaaagttatttcctggagaagatggaggaaaaccactac
aacacatatcagtctcaaaagtacggtgaaaactggtacgtcggaataaaaaagaacggg
aaaatgaaacggggcccaagaactcacatcggacaaaaggccattttctttcttccacga
caggtggagcaggaagaggactga

DBGET integrated database retrieval system