KEGG   Danio rerio (zebrafish): 393884Help
Entry
393884            CDS       T01004                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00020  Citrate cycle (TCA cycle)
dre00190  Oxidative phosphorylation
dre01100  Metabolic pathways
dre01200  Carbon metabolism
Module
dre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dre_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    393884 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    393884 (sdha)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     393884 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 393884
NCBI-ProteinID: NP_957204
ZFIN: ZDB-GENE-040426-874
Ensembl: ENSDARG00000016721
Vega: OTTDARG00000032328
UniProt: Q7ZVF3 B2GQ13
LinkDB All DBs
Position
19
AA seq 661 aa AA seqDB search
MAAVCAASRVLGTKILSSKSLPAVCQANRQLHFSIYGKRGDAKISDGVSNQYPVVDHEFD
AVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEQDDWRWHF
YDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTDDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECKGVIALCMEDGS
IHRFRAKNTVIATGGYGRTFFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIYGA
GCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPDKDH
VHLQLHHLPPQQLAARLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVIT
YKDGQDHVVPGLYACGEAGCASVHGANRLGANSLLDLVVFGRACALTIAEIDTPGEKLSP
LKPNAGEASVANLDKMRYANGSTRTSEIRLNMQKTMQSHAAVFRTGDVLKEGCVKMESVY
KSMDNIKTFDRGIVWNTDLVETLELQNLMLNAVQTIVSAEARKESRGAHAREDFKDRVDE
YDYSKPLQGQVKKPFEQHWRKHTLSYVDPETGKVTLEYRPVIDSSLDAEDCAAIPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggtgtgcgctgcatcccgtgtcctcgggacaaagattttgtcaagtaaatct
ctaccagcagtgtgccaagcgaaccgtcagttgcatttctccatctatggaaaaagggga
gacgcaaaaatctcagatggagtctccaatcagtatccagtagtagatcatgagtttgat
gcagtcgtggttggagctggcggtgccgggctgcgtgcagcgttcggtctgtctgaggcc
ggcttcaacactgcctgcgtcaccaaacttttcccaacacgctcgcacacagtggccgca
cagggtggcattaatgctgcgttaggcaacatggagcaggatgactggcgttggcacttt
tatgacacggtgaagggctctgattggctgggagaccaggatgccattcactacatgacc
gagcaggctcctgcagcagtggtggagctggagaactttggtatgccgttcagccgtact
gacgatggcaagatctaccagcgtgctttcggaggtcagagtctgaagtttggcaaagga
ggtcaggctcacagatgctgctgtgtggcggacaggacgggacactcgcttctgcacact
ctctatggacggtctctgaggtacgataccagctactttgtggagtattttgctctggat
ctgctgatggaggatggagagtgtaagggagtcattgcactctgcatggaggacggatca
atccaccgtttcagagcaaagaacacagtcattgccactggtggttatggccgcacattc
ttcagctgcacctcagcccacactagcacaggagacggtaatgccatggtgacgcgtgct
ggactgccctgccaggatctcgaatttgttcagttccaccccacaggtatctatggagct
gggtgcctgatcactgagggctgtcgtggagagggaggaatcctaatcaacagtgaagga
gagagattcatggagcgttacgcacccaatgccaaagacttggcctccagggatgtggtt
tcaagatccatgaccatagagatcagagagggaaggggtgttgggccggataaagaccac
gtgcacctgcagctccatcatcttcctcctcagcagctggccgctcgcctgcccggcatc
tctgagaccgccatgatttttgcaggagtggacgtcaccaaagagcctatcccagtttta
cccacagtccactacaacatgggtggcatccccaccaactacaagggacaggtcatcacc
tataaagatggacaggatcatgttgtgccaggcctgtacgcctgtggagaggctggctgc
gcatcagttcacggtgccaaccgcctgggcgcaaactccctgctggatcttgttgtgttt
ggacgtgcctgtgccctgaccattgctgagattgacaccccaggagagaagctttctcct
ctgaaacccaatgcaggagaggcatcggtcgctaatcttgacaagatgcgctatgctaac
ggcagcaccagaacctcagagatcagactcaacatgcaaaagactatgcagagtcacgca
gctgtgttccgtactggagatgttctgaaggagggttgtgtcaagatggagtccgtctat
aagtcgatggataacattaagacatttgatcgaggtattgtgtggaacaccgatctggtg
gaaacgctggagctgcagaatctgatgttgaacgcggtgcagaccatcgtcagcgctgag
gctcgtaaagaaagtagaggcgctcatgcccgcgaggacttcaaggatcgtgtggatgag
tatgattattccaagcctctgcagggacaagtgaagaagcctttcgagcagcactggagg
aaacacacactgtcctatgtggatcccgaaacaggaaaggtaactctggagtacagaccc
gtgatcgacagctctctggacgctgaagactgtgccgccattcctcctgcaatccgttcc
tattaa

DBGET integrated database retrieval system