KEGG   Danio rerio (zebrafish): 403029Help
Entry
403029            CDS       T01004                                 

Gene name
pofut1
Definition
(RefSeq) GDP-fucose protein O-fucosyltransferase 1 precursor
  KO
K03691  peptide-O-fucosyltransferase [EC:2.4.1.221]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    403029 (pofut1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    403029 (pofut1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.221  peptide-O-fucosyltransferase
     403029 (pofut1)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  O-linked Fuc type
   403029 (pofut1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: O-FucT Hfx_Cass5
Motif
Other DBs
NCBI-GeneID: 403029
NCBI-ProteinID: NP_991281
ZFIN: ZDB-GENE-040303-2
Ensembl: ENSDARG00000008953
Vega: OTTDARG00000034092
UniProt: F1R676
LinkDB All DBs
Position
23
AA seq 395 aa AA seqDB search
MAARPKHLKLFIVTYLHTSLIFLNVFIDATDVTWDENGYILYCPCMGRFGNQVDHFLGSL
AFAKMLNRTLAVPPWIVYRHHSPPFANVHVPYSEYFQLEPLKQYHRVVSLEDFMEHLAPK
HWPHGQRIAYCFESAAHRSQDKKSCPMKDGNPFGPFWDHIGVDFDRSVLFGGLSFSSYYQ
PHWIKRFPPKEHPVLALPGAPAQFPVLEEHIGLQQFVVWSDRIVQEGEGHIRNLLNRPYV
GIHLRIGSDWQNACKLLKTGDTGPHFMASPQCVGYDRQTALPLTMNMCLPDLTEIRRAVK
LWVKNTGAQSVYIATDSESHTTEIQKLFKGKVKVVSLQPDTAQVDLYILGQADHFIGNCV
SSFSAFVKRERNIHGRPSSFFGLDYPGKKNRNEEL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgagaccaaagcacctgaaacttttcattgtaacttatttgcacacatcactc
attttcctcaatgtatttatcgacgctacagacgtgacgtgggatgaaaatggatacatt
ctgtactgtccgtgcatgggtcgctttggaaaccaggtggatcactttcttggatcactg
gcttttgctaaaatgctgaaccgaactctcgcggttccgccgtggattgtttaccgccat
cactcgccgccttttgctaatgtgcatgttccatacagtgagtatttccagcttgagccg
ctgaagcagtaccaccgtgtggtgagtctggaggacttcatggagcacttggctcctaaa
cactggcctcatggtcagagaatcgcttactgctttgagtccgcagcgcacaggagccag
gacaaaaagagttgtcctatgaaggatggaaatccttttggtccgttctgggaccatatt
ggagtggactttgaccgatccgttctttttggaggtctttcattcagctcctactaccag
ccacactggattaaaaggtttccgccaaaggagcatccggttcttgctcttccaggagcc
ccggcgcagtttcctgtgttggaagagcacattggtctgcagcagtttgtggtttggtct
gacagaattgtacaggaaggagaaggtcacatcagaaacctgctgaacagaccctacgtg
ggcatccatctgaggatcggctctgattggcaaaacgcctgcaagctgttgaaaacgggt
gatactggtccacactttatggcgtctccacagtgtgtaggatatgaccgtcagactgct
ctgccactgaccatgaacatgtgtttacctgatctgacggagatccgccgagctgtgaaa
ctctgggtgaagaacactggtgctcagtctgtatacatcgccacagactcagagtcgcac
accacagagattcagaaactcttcaagggcaaggtgaaagtggtgagcttgcagccggac
actgctcaggttgacctgtacatcctcggacaggctgatcacttcatcggcaactgtgtt
tcatccttctctgcctttgtcaaaagagagagaaacattcacgggagaccctcgtctttc
tttggactggactaccctggaaaaaagaacagaaatgaagaactctaa

KEGG   Danio rerio (zebrafish): 777668Help
Entry
777668            CDS       T01004                                 

Gene name
pofut2
Definition
(RefSeq) GDP-fucose protein O-fucosyltransferase 2
  KO
K03691  peptide-O-fucosyltransferase [EC:2.4.1.221]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    777668 (pofut2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    777668 (pofut2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.221  peptide-O-fucosyltransferase
     777668 (pofut2)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  O-linked Fuc type
   777668 (pofut2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: O-FucT
Motif
Other DBs
NCBI-GeneID: 777668
NCBI-ProteinID: NP_001071098
ZFIN: ZDB-GENE-030131-3595
Ensembl: ENSDARG00000045175
Vega: OTTDARG00000025948
UniProt: B0S641
LinkDB All DBs
Position
9
AA seq 444 aa AA seqDB search
MATNRGTAVSVHLHHILGYITVFIFVILSSNSSSASEDDAFRAGQSMFSPVAAASRDVRY
LLYDVNPPEGFNLRRDVYIRMATLLKTLRKEGDWVLVLPPWGRLYHWQSPEIHQLRIPWG
EFFSITSLQANIPVIEYEEFIAESGGPFIDQILVLQSYAEGWTDGKWEEKVDDRPCIEKL
MYSKDKQGYYRGWFWGFEETRALNVTCLSAQGHASILAPVLQNNITATSVMVDRAETVLH
DHYAGKDYWDTRRSMVFAKHLRIIGDKFRANHLNSTDKQDQTPYNEDWTQMKNPLGSAKG
GPYLGVHLRRKDFIWGHREDVPSLKGAVKKIRSLMKKHKLLQVFVATDADEEELAKLKRL
LPEMVRFEPSLEDLELLKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGFDPK
TTYNRFCGDVEQECEQPTHWKIVY
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaacaggggaacagctgtgtctgtccatctccatcatattttaggatatatt
acagtatttatctttgttattttatctagtaactcgtcgtctgcttcagaggacgatgca
tttcgcgccggtcagtcgatgttttcaccggtggctgcagcatcacgggatgttcgctac
ctcctgtatgatgtgaatccacctgaaggcttcaatctcagacgggatgtttatatccgc
atggccactttgctgaagacgttgaggaaagagggtgactgggtgctggttttgcctcca
tggggacgactgtatcactggcaaagccctgaaatacatcagctccgcatcccgtggggt
gaattcttcagcataaccagcctgcaggctaacataccagtcattgaatacgaggagttt
attgctgagtctgggggtcccttcattgaccagatccttgtgctgcagagctatgcagag
ggctggacggatggaaaatgggaggagaaggtggatgacagaccgtgtattgaaaagctg
atgtactcaaaagacaaacagggttattacagaggttggttttggggttttgaggagacc
agagcattgaatgtcacctgtttatctgctcaaggacatgcatctatcctggcccctgtc
ttacaaaataacataacagccacgtcagtaatggtggacagagccgagactgtccttcat
gatcactatgctgggaaagactactgggatacacggcgaagtatggtgtttgccaaacac
ttgcgcataataggagacaagtttagagccaatcatctcaactccacagataaacaagac
cagacaccgtacaatgaggactggactcaaatgaaaaaccctctggggagtgctaaaggt
ggcccttacctgggggtccatttacggaggaaggactttatttggggtcacagagaagat
gtgcccagtcttaaaggtgcagtgaagaagatccgtagtctcatgaagaagcacaagcta
ctgcaagtctttgttgctactgatgcagatgaggaagagcttgctaaactaaaacggctg
ctgcccgagatggtacggtttgagcccagcttggaggatctggagctcctgaaagatgga
ggagtagccattatagaccagtggatctgtgctcatgccaggtttttcattgggacatca
gtttcaaccttctctttccgaatacacgaagaaagagaaatcctaggttttgatcctaaa
accacttataatcgattctgcggtgatgttgagcaggaatgcgaacaacccacacactgg
aaaattgtatactga

DBGET integrated database retrieval system