KEGG   Danio rerio (zebrafish): 403045
Entry
403045            CDS       T01004                                 

Gene name
egf
Definition
(RefSeq) pro-epidermal growth factor isoform 1 precursor
  KO
K04357  epidermal growth factor
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04068  FoxO signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    403045 (egf)
   04012 ErbB signaling pathway
    403045 (egf)
   04068 FoxO signaling pathway
    403045 (egf)
   04020 Calcium signaling pathway
    403045 (egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    403045 (egf)
   04540 Gap junction
    403045 (egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    403045 (egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    403045 (egf)
Cytokines and growth factors [BR:dre04052]
 Growth factors
  Growth factors (RTK binding)
   403045 (egf)
SSDB
Motif
Pfam: Ldl_recept_b cEGF FXa_inhibition EGF_CA EGF_3 DUF5050 EGF EGF_MSP1_1 hEGF
Other DBs
NCBI-GeneID: 403045
NCBI-ProteinID: NP_001352456
ZFIN: ZDB-GENE-070922-1
Ensembl: ENSDARG00000052739
Vega: OTTDARG00000028045
LinkDB
Position
14
AA seq 1177 aa
MCWRTIALTFGLWSWMVSMDPLRASGPAEEALCWGGRAWAAGNFNCVEPEPYLIVGLGNS
IQRMNLDGGDRRRIVSRAGRSILLDFHLSEWTMFWADTQTGQIRRAGLDGTRRQKLLSSV
KGITGLVVDWIENSVLWSNADEGTIQRMDTDGRNDRVVLRNLSQPRGVVVDPNERYIFWL
SDGATSSIQRSDMTGKMMSTVLKVADRLKVLAVDHRDRRLFWVQQGQRGHTAMGSCNYDG
NIINVFNQQFRPQSLRMTIFLDYVYLSDSKSKTITRLNKYTGGRQENVSSQRMPHSPADV
KVVHPINQPVVETPFTPGCSRHTGECVKVCSSHTDTGLCGCKDGFTLSKHGNICEDVNEC
SLWNHGCSLGCENVPGSYFCTCPEGYLLLPDLKTCQENKPCVGKAVDCDHACVHTAQGDM
CVCPEGSLLNPDGQSCTGCFSADRGGCSQMCVTLYPGRWVCECHPGYQIQPDGKHCAATG
PPADLLFANIVDLRKINTDGKLSIKLLEKPGGNITAVDYDPVTNKVYFADKGLKHIERAS
LDEGFRELLVSTGLNSPEALAVDWIQRKLYWTDSGLSSISRSSLNGLDREIFINENIQKP
RGIALHPQAQKIYWTDMGDRPAVERSGLDKDLREAVVSTGLVSPSGLAVDHGSQRLYWCD
MSTSVIESANLDGSHRRVISQNQVDRPFDIAVFENVLWVSDLENHLIFRLDMRSGQNPER
LLVDSIQPAALVVVHPLAKPGADVCLDGNGGCAQVCVSRLGLPHCSCHTNHVLSADGKGC
RMINASFSESSEGGSNDGLRNKTLNDESTPLAMLYTEKMVSDQDDCFSLSCVVNAQCFLQ
EGRAVCQCVRGFTGDGELCVDVDECKAGLADCSVSEAECVNTAGGYFCQCKNGFSGDGHH
CVDIDECRLDLHDCDVNAECLNAVGEYQCRCRSGFTGTGFSCQAEFNGTSLWPSTASPPD
VTSTLQHKNGVQSCPSTHDSYCLYDGVCFYFPDMESYACNCVLGYMGERCQFSDLEWWEL
QQAEEGKRRNMVIAVCIVLLITILSIAACITFCYRPKRHFGGCSLQDSVGEMSASEDSFT
ETTTATPEVYVVLDTSTCTADKVLHVQSTTSTICSSCPTQTGDRFSSEEAGKLQRDGCSL
AVAICSVSCDIPKILLTEKTTDNLISLEDAQSPTSSQ
NT seq 3534 nt   +upstreamnt  +downstreamnt
atgtgctggaggacgatagcgctcacttttggattgtggtcgtggatggtgagtatggac
cccctacgagcttcaggccctgccgaggaggctttatgttggggtggacgagcctgggct
gctggaaacttcaactgtgtggaacctgagccatatctaatagtcggcctcggaaatagc
atccagagaatgaacctcgatggaggggaccggagaagaatcgtttccagggcgggaagg
tccattttgttggactttcacttaagtgagtggacgatgttttgggcggacacacaaaca
ggacaaatcagaagagcaggactagatggaacacggagacagaagcttctctcctcagtg
aagggaatcacgggtctggttgtggactggattgaaaactcagtcctctggagcaatgca
gatgaaggaacaatacagagaatggacactgatggcaggaacgacagagttgtcttgaga
aatctgtctcagcctagaggtgttgttgttgatccaaatgaaagatatattttctggttg
tcagatggagcgacttccagcatccagcgatcagacatgacaggtaaaatgatgagcaca
gtgctgaaagtagcggacagactgaaggttctggctgttgaccaccgggacaggagactt
ttctgggttcagcaaggccaaagaggacacactgctatgggctcctgcaactatgatgga
aacattatcaatgtctttaatcagcaattcagacctcaatctctgagaatgacgattttc
ttggattatgtgtatctgtcagactcaaagtcaaaaacaataactcgattgaacaagtac
acagggggtcgacaagagaatgtcagttctcaaaggatgccacattcccctgctgatgtt
aaagtggtgcatcccatcaatcaaccggtggtggaaactccttttacacccggctgcagt
cgacacacaggagagtgtgtgaaagtgtgctccagtcacactgacactggtctctgcggc
tgcaaggatggatttaccctcagtaaacatggaaacatctgtgaagatgtcaatgaatgt
tccctatggaatcacggctgctctctgggatgcgagaacgttccgggctcttacttctgc
acctgtcctgagggttacctgttactgcccgatttaaagacctgccaagagaacaagcct
tgtgtggggaaagctgtggattgtgatcatgcatgtgttcacacagcacaaggagatatg
tgtgtgtgtcctgaaggatccctactcaatcctgatggccaatcttgtacaggctgtttt
tctgcagatcgtggcggctgcagtcagatgtgtgtgactttatatccaggccggtgggtt
tgtgaatgccatcctggataccaaatacagcctgatggaaaacactgcgctgccactgga
cctccagcggacctgttgtttgccaatatagtggatttaaggaagattaacacggatggc
aaactgagcataaaactgctggaaaaaccaggaggcaatattacagcagtggactatgat
ccagtgacgaacaaggtgtattttgctgataaaggcctgaagcacattgagagagcttct
ctggatgaaggattcagagagctgctcgtctctactggactgaactcccctgaggctctg
gctgtagactggattcaacgcaagctctactggactgatagtggattgtcctcgatttcc
cgcagcagcttaaatggtcttgacagagagatctttattaatgaaaacatccagaaaccc
agaggcatcgctcttcatcctcaggcacagaagatatattggacagatatgggtgatcgt
cctgcagtggagcggtcaggtctggacaaagacctgcgtgaagcagtggtcagcaccggt
ctggtgtctcccagtggactggctgtggatcatggctctcagcgtctgtactggtgtgac
atgagcacaagtgtgattgagtcagccaacctggatggttctcatcgccgtgtaataagc
cagaaccaagtagatcgtccatttgatatcgcagtatttgagaacgtgctctgggtcagt
gatctggagaatcacctgatcttccggctggacatgagatctggtcaaaaccctgagcgt
ctacttgttgactccattcaaccagctgctctggttgttgtccatcctcttgccaaacca
ggagcagatgtttgtctggatggaaatggaggatgtgctcaagtgtgtgtgagcagactg
ggactccctcactgctcctgtcacaccaatcacgttctttcagctgatggcaaagggtgt
cggatgattaatgcatcattcagtgagtccagtgaaggtggatcaaatgatggtctaaga
aacaaaaccctgaatgatgagagcacaccactggcaatgctttacacagagaagatggtt
tcagatcaggatgactgcttctctctcagctgtgttgtgaacgctcagtgttttctgcag
gagggccgggctgtgtgtcaatgtgtgaggggtttcactggtgatggggagttatgtgtg
gacgttgatgaatgcaaagcaggcctggcagattgtagtgtttctgaggctgaatgtgtg
aacacagcgggcggatatttctgtcagtgcaaaaatggattcagcggagatggtcatcac
tgtgttgatatagatgagtgtcgactagatttgcatgactgcgatgtaaacgctgaatgt
ttaaatgccgtaggagaatatcaatgtagatgccgatctggcttcacaggcactggtttc
agctgtcaagcagagtttaatggcacctccttgtggccgagtactgctagtcctcctgat
gtcacttcaacattgcaacacaaaaatggcgtgcagagctgcccctctacacatgactcg
tattgtctgtatgatggagtctgcttctattttcctgacatggagtcttacgcctgcaac
tgtgtgctaggttacatgggggagcgctgtcagttcagtgatcttgaatggtgggagttg
cagcaggctgaagaggggaagaggaggaatatggttatagccgtgtgtattgtgctcctc
atcaccattctctccatcgctgcctgcatcaccttctgctataggcctaaaagacatttt
ggagggtgttccttacaggacagtgtaggagaaatgagtgcgagtgaagacagtttcact
gagaccacaacagccactccagaggtctatgtagttttggacacttctacttgcactgct
gataaggtccttcatgtacagtctaccacatcaacaatatgctcctcttgccctacacaa
acaggagacagattttcttcagaagaggctgggaagctacaaagagatggttgtagcctg
gctgttgccatctgctccgtatcctgcgatattcccaaaatactgctcacagagaaaacc
actgataatctaatctccttagaggatgctcagagtccgacatcatcccagtga

DBGET integrated database retrieval system