KEGG   Danio rerio (zebrafish): 403052
Entry
403052            CDS       T01004                                 

Gene name
map2k4a
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4a
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04620  Toll-like receptor signaling pathway
dre04912  GnRH signaling pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    403052 (map2k4a)
   04012 ErbB signaling pathway
    403052 (map2k4a)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    403052 (map2k4a)
  09152 Endocrine system
   04912 GnRH signaling pathway
    403052 (map2k4a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    403052 (map2k4a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    403052 (map2k4a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     403052 (map2k4a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE7 family
   403052 (map2k4a)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal Choline_kinase APH
Other DBs
NCBI-GeneID: 403052
NCBI-ProteinID: NP_991299
ZFIN: ZDB-GENE-060512-98
Ensembl: ENSDARG00000063583
Vega: OTTDARG00000035191
UniProt: B1NA68
LinkDB
Position
3
AA seq 404 aa
MATSSPSSNPASASNNPTQLHPAQSQHITTMSSMQGFQINLSGLPPSKRKALKLNFANPP
IKTTSRITSGLPFQNPHIERLRTHSIESSGKLKISAEQHCDFTAEDLKDLGEIGRGAYGS
VNKMAHKPSGQIMAVKRIRSTVDEREQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCW
ICMELMSTSFDKFYKYVYSSLDEVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNI
LLDRKGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGI
TLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSSSEERQFSPKFINFVNLCLTKDESKR
PKYKELLKHAFIQMYEERSVDVATYVCRILDQMPPSPSSPMYVD
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggcgacgtccagcccaagcagtaacccagcgtcagcctccaacaacccaacgcagctc
cacccggcccagagccagcacatcaccaccatgagcagcatgcaagggtttcagataaac
ctgtctggacttcctccaagtaaacgtaaagccctgaagttaaattttgccaatcctcca
atcaaaaccacttccagaatcacttccggacttcctttccagaacccacacatagagcgg
ctgcgaacacacagtatcgagtcgtctgggaagctgaagatctcagcggagcagcactgc
gatttcacagcagaagacctgaaggatctcggtgagatcggcagaggagcgtatggctcg
gtcaacaagatggcgcacaaacccagtggacaaatcatggccgtcaagaggattcgttca
acagtagacgagcgagaacagaagcagctgctgatggatctggatgtggtcatgaggagc
agcgactgtccgtacatcgtccagttttacggggctcttttcagagagggggattgctgg
atatgcatggagctcatgtctacctccttcgacaaattctacaaatatgtttattcctct
ttagacgaagtgattccagaggagattttagggaaaataacattagctactgtgaaagca
cttaaccacttaaaagaaaacttgaaaattattcacagagacataaagccatcaaatatc
ctcctggacaggaaaggcaacattaaactgtgtgattttggcatcagtgggcagctggtt
gactccatcgccaaaaccagagacgcaggctgcagaccgtatatggcaccggagaggata
gaccccagcgcctccagacagggttatgacgtgcgctcggatgtgtggagtttgggcatc
acactgtatgagctggccacgggacgcttcccctaccccaagtggaacagtgtgtttgac
cagctgacgcaggtggtgaagggcgacccaccacagctcagcagctccgaggagagacag
ttctcccccaagttcatcaacttcgtcaacctgtgccttacaaaggacgagtcaaaaagg
ccaaagtacaaagagcttctgaaacatgcgttcatccagatgtacgaggagcgctcggtg
gacgtggccacttacgtctgcaggatcctggatcagatgccaccgtctcccagctccccg
atgtacgtggactga

KEGG   Danio rerio (zebrafish): 560913
Entry
560913            CDS       T01004                                 

Gene name
map2k7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04141  Protein processing in endoplasmic reticulum
dre04530  Tight junction
dre04620  Toll-like receptor signaling pathway
dre04912  GnRH signaling pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    560913 (map2k7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    560913 (map2k7)
   04012 ErbB signaling pathway
    560913 (map2k7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    560913 (map2k7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    560913 (map2k7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    560913 (map2k7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    560913 (map2k7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    560913 (map2k7)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     560913 (map2k7)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE7 family
   560913 (map2k7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 560913
NCBI-ProteinID: NP_001177235
ZFIN: ZDB-GENE-090312-186
Ensembl: ENSDARG00000008279
Vega: OTTDARG00000030074
UniProt: D6RRB7
LinkDB
Position
1
AA seq 438 aa
MSSLEQRLSRIEEKLKQENKEARKRIDLNIDMSPQRTRPRPIIVIQLSPAPAPSQRAALQ
LPLANDGGSRSSSSESSPQHPSYPNRPRQMLTLPTTPYNLQKNLENAEIDQKLQEIMKQT
GYLKIDGQRYPAEVTDLISEGEIGSGTCGQVFKVRFKKTGHVIAVKQMRRTGNKDENKRI
LMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMT
VAIVNALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAY
MAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPVL
PLSMGFSPDFQSFVKDCLTKDHRKRPKYHKLLEHSFIRRYEVSEVDVAGWFQAVMERTES
PRSSQCFSHHQLHSLFSR
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgtcgtcgctggagcagagactctcccgaatcgaggagaaactcaagcaggaaaataaa
gaagctcgcaaacggatcgacctgaacatcgacatgagcccgcagcggacgcgcccgagg
ccaatcatcgtgatccagctcagtccagctccagccccttcccagcgcgcagctctacag
ttgcctttggccaacgatggaggcagtcgctcgtcctcgtcagaaagctcccctcaacac
ccctcgtaccccaatagaccccgacaaatgctcacacttcccacaacaccgtacaaccta
caaaagaacctggagaatgctgaaatcgatcagaagttgcaggaaatcatgaaacaaacc
ggatatttgaagattgatggacagcgttaccccgcagaggtgactgatctaatcagtgag
ggggagatcggcagtggaacctgtggacaggtgtttaaagttcgttttaagaagactggc
catgtcatcgcagtcaagcaaatgagaagaacgggtaacaaagatgagaataagagaatc
ctcatggatctggatgttgtattgaagagtcacgactgtccatacatcattcagtgctat
ggggcaatagtcaccaatacggatgtgttcattgccatggaactaatgggaacgtgtgca
gagaagctgaagaagaggatccaagggcccataccagaggccattctgggaaagatgacc
gtggctattgtgaatgctctgctttatctaaaagagaaacatggtgtcatacaccgagac
gtaaagccatctaatatcttgttggacgccaaagggcagatcaaactgtgtgattttggc
attagcggtcgattggtagattctaaggccaagactcgcagcgccggctgtgctgcgtac
atggcgcctgagagaatagaccctccagaccccagtaagccagattatgacatcagagcc
gacgtctggagtcttggcatttctctggtggagctagccacaggacagtttccttacaag
aactgcaagacagactttgaggttcttaccaaagttctgcaagaggacccgccagtgctt
cctctcagcatgggcttttcccctgactttcagtccttcgtcaaagactgcctcacaaag
gatcacagaaaaaggccaaaataccacaagctgcttgaacacagtttcatccgtcgttac
gaggtgtcagaagtggacgttgcgggctggtttcaggcggtgatggagcgcacagagtct
cctcgcagcagtcagtgcttcagccatcaccagctccactctctcttcagtaggtag

KEGG   Danio rerio (zebrafish): 568951
Entry
568951            CDS       T01004                                 

Gene name
map2k4b
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4b
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04620  Toll-like receptor signaling pathway
dre04912  GnRH signaling pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    568951 (map2k4b)
   04012 ErbB signaling pathway
    568951 (map2k4b)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    568951 (map2k4b)
  09152 Endocrine system
   04912 GnRH signaling pathway
    568951 (map2k4b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    568951 (map2k4b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    568951 (map2k4b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     568951 (map2k4b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE7 family
   568951 (map2k4b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase
Other DBs
NCBI-GeneID: 568951
NCBI-ProteinID: NP_001082890
ZFIN: ZDB-GENE-080721-13
Ensembl: ENSDARG00000077177
Vega: OTTDARG00000039852
UniProt: A4UU31
LinkDB
Position
12
AA seq 417 aa
MAAPSSDSGSSCGGGGTAGPAGLSPRLGSIGAQDSNSCWRCQNETGFQINLSGVTQIKRK
ALKLNFANPPVKPAARLPITSTAPAFQNPHIERLRTHSIESSGKLKISPEQHCDFTAEDL
KDLGEIGRGAYGSVNNMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIV
QFYGALFREGDCWICMELMATSLDKFYKYVYCASDDVIPEEILGKITLATVKALNHLKEN
LKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQ
GYDVRSDVWSLGITLYELATGRFPYPRWNSVFDQLTQVVKGEPPQLCSSEDRQFSHKFIQ
FVNLCLTKDESKRPKYRELLKHPFILMYEERLVDVARYVCRILDQMPASPGSPMYVD
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcggctcccagcagtgactctggctcttcgtgcggtggcggcggtactgcgggacca
gcgggactctcaccgcgactcggctccatcggtgctcaggattcaaactcctgctggcgc
tgtcagaatgaaacagggtttcagatcaatctgtctggagtaacccaaatcaaacgcaaa
gcgctgaagctgaactttgccaatccgccagtgaagccggcggcgcgtctgcccatcacc
agcactgcaccggccttccagaacccacacatagagcggttgcggacacacagcatcgag
tcttcaggcaaactgaagatttctccagaacagcattgtgatttcacggccgaggacctc
aaggatctgggggagatcgggagaggagcgtacggatccgtcaacaacatggtgcacaaa
cccagcgggcagatcatggctgtcaagaggattcgctccacggtggatgagaaagagcag
aagcagctgctgatggatctggacgtggtgatgaggagctccgactgcccatacatcgta
cagttctacggcgctctcttcagagagggcgactgctggatctgtatggagctcatggct
acctccctcgacaagttctacaaatatgtatattgtgcgtcagatgacgtcattccagag
gaaatattaggcaaaattacattagcaactgtgaaagcactgaatcacttgaaggaaaac
ttgaaaataatccacagagacatcaagccctccaatattctcctggacagaaacggcaac
attaagctgtgtgatttcggcatcagcgggcagctggtggactccatcgccaagaccaga
gacgccggctgcagaccctacatggctcctgaacgcatcgaccccagcgcctccagacag
ggctacgatgtgcgctcagacgtctggagtttgggaatcacactgtatgagctggccacg
ggccgcttcccgtacccgcgctggaacagtgtgtttgatcagctgacgcaggtggtgaag
ggggagccgccgcagctctgcagctctgaggaccgacagttctcacacaagttcatccag
ttcgtcaacctatgccttacgaaggacgagtcaaagaggccaaagtacagagagctgctg
aagcatccgtttatcctgatgtacgaggagcgtctggtggacgtggcccgatacgtgtgc
cggatcctggaccagatgccggcgtcccccggctctcccatgtatgtggactga

DBGET integrated database retrieval system