KEGG   Danio rerio (zebrafish): 406308
Entry
406308            CDS       T01004                                 

Gene name
grb2b
Definition
(RefSeq) growth factor receptor-bound protein 2b
  KO
K04364  growth factor receptor-bound protein 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04150  mTOR signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    406308 (grb2b)
   04012 ErbB signaling pathway
    406308 (grb2b)
   04068 FoxO signaling pathway
    406308 (grb2b)
   04150 mTOR signaling pathway
    406308 (grb2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    406308 (grb2b)
   04540 Gap junction
    406308 (grb2b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    406308 (grb2b)
   04912 GnRH signaling pathway
    406308 (grb2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    406308 (grb2b)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    406308 (grb2b)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    406308 (grb2b)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   406308 (grb2b)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 hSH3 SH2_2 SH3_4 DUF5093
Other DBs
NCBI-GeneID: 406308
NCBI-ProteinID: NP_998200
ZFIN: ZDB-GENE-040426-1975
Ensembl: ENSDARG00000038059
Vega: OTTDARG00000019850
UniProt: Q6PC73
LinkDB
Position
3
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGEILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKAHPW
FFGRIPRARAEEILNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRTTSVSRNQQIFLRDIEQVPQHPTYVQALFDFDPQEDGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNRNM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggccattgccaagtatgatttcaaagcaactgcagatgatgagctgagttttaaa
cgtggggaaatattgaaggtattaaatgaagagtgcgatcagaactggtataaggcagaa
ctaaacggcaaagacggtttcattcctaaaaactacattgagatgaaggcacatccgtgg
tttttcgggagaatccccagagcccgagcggaggagatcctgaacaaacagaggcatgac
ggagcttttctcatcagagagagcgagagcgcgcctggagacttctcactgtctgtcaag
tttggtaatgatgttcagcacttcaaagtgcttcgtgacggtgctggaaagtacttcctc
tgggtggtgaagtttaactctctgaatgagctggtggattatcaccgcaccacttctgtt
tccagaaaccagcagatctttctccgagacatcgagcaggtgcctcagcatccgacgtac
gtgcaggcgctgtttgacttcgaccctcaggaggacggcgagctgggcttcagacgcgga
gacttcattcaggtcctggacaactcggaccccaactggtggaagggtgcctgccatggc
cagacgggcatgttccctcgcaactatgtcacgcccgtcaaccggaacatgtaa

KEGG   Danio rerio (zebrafish): 493609
Entry
493609            CDS       T01004                                 

Gene name
grb2a
Definition
(RefSeq) growth factor receptor-bound protein 2a
  KO
K04364  growth factor receptor-bound protein 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04150  mTOR signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493609 (grb2a)
   04012 ErbB signaling pathway
    493609 (grb2a)
   04068 FoxO signaling pathway
    493609 (grb2a)
   04150 mTOR signaling pathway
    493609 (grb2a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    493609 (grb2a)
   04540 Gap junction
    493609 (grb2a)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    493609 (grb2a)
   04912 GnRH signaling pathway
    493609 (grb2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    493609 (grb2a)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    493609 (grb2a)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    493609 (grb2a)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   493609 (grb2a)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 hSH3 SH2_2 SH3_4 DUF5093
Other DBs
NCBI-GeneID: 493609
NCBI-ProteinID: NP_001007770
ZFIN: ZDB-GENE-041121-1
Ensembl: ENSDARG00000105276
Vega: OTTDARG00000018174
UniProt: Q5RKN6
LinkDB
Position
6
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGEILKVLNEECDQNWYKAELNGKEGFIPKNYIEMKPHPW
FYGKIPRAKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNSLVDYHRSTSVSRNQPIFLRDIEQVPQNSTYVQALFDFDPQEDGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNQNM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggcaatagctaaatatgacttcaaagctactgcggatgatgaattaagtttcaag
cgaggagagattcttaaggttttaaatgaagaatgtgaccagaattggtacaaggctgaa
ctcaacggaaaagaaggattcatccctaaaaattacatagaaatgaagccacacccctgg
ttttatgggaagattccccgtgcaaaggcagaagaaatgctaaataaacagaggcacgat
ggagcttttcttataagggagagtgaaagtgcacctggagacttctcgctctctgttaaa
tttggaaatgatgtccagcacttcaaagttttacgggacggagctggaaaatatttcttg
tgggtggtcaaatttaactcgttaaactctttagtggattatcatcgctccacttctgtg
tccaggaatcagcctattttcctcagggacattgaacaagtaccacagaattcaacatat
gttcaagctttgtttgacttcgaccctcaagaggatggagagttgggtttcaggcgtgga
gattttatccaggtcctggacaactctgatcctaattggtggaagggggcttgtcacgga
caaaccggaatgtttcctcgcaattatgtcacacctgtcaatcaaaacatgtaa

DBGET integrated database retrieval system