KEGG   Danio rerio (zebrafish): 406349
Entry
406349            CDS       T01004                                 

Gene name
rps6kb1b
Definition
(RefSeq) ribosomal protein S6 kinase beta-1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04350  TGF-beta signaling pathway
dre04371  Apelin signaling pathway
dre04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    406349 (rps6kb1b)
   04350 TGF-beta signaling pathway
    406349 (rps6kb1b)
   04371 Apelin signaling pathway
    406349 (rps6kb1b)
   04150 mTOR signaling pathway
    406349 (rps6kb1b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    406349 (rps6kb1b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    406349 (rps6kb1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    406349 (rps6kb1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     406349 (rps6kb1b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   406349 (rps6kb1b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 406349
NCBI-ProteinID: NP_998241
ZFIN: ZDB-GENE-040426-2038
Ensembl: ENSDARG00000058230
Vega: OTTDARG00000020711
UniProt: Q802Y7
LinkDB
Position
15
AA seq 502 aa
MAGVFDIDLDQPEENVSDDELEEAQINELMDQCSGFEFNMDDCEKIEISEDNVNQGTENI
RPECFELLRVLGKGGYGKVFQVRKVSGAATGKIFAMKVLKKAMIVRNAKDTAHTKAERNI
LEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMAL
GHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILM
RSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKR
LLKRSASSRLGAGPGDATEVQTHPFFRHVNWDDLLARKVEPPFKPFLQFAEDVSQFDSKF
TSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENIKEKFSFEPKIRSPRRFLGSPRTPL
SPIKFSGDCWPRGPTLPGSSTLQSPTELAMEVSSVDHMDVQASAEATAPLPIRQPAGSNM
GQFKQQAYPVISKRPEHLRMNL
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggctggcgttttcgacatcgatctggaccagccagaggagaatgtgtccgatgacgag
ctggaggaggctcagatcaatgagctcatggaccagtgcagtggctttgagtttaacatg
gatgactgtgagaagattgagatatcagaggacaatgtgaaccaaggcacagagaacatc
cgtccggagtgctttgagcttctccgtgttttagggaaaggaggttatggaaaggttttc
caagttcggaaagtatctggtgctgcaacaggaaaaatatttgcaatgaaagtcttgaag
aaggctatgattgtacgcaacgccaaggacacagcgcatactaaagcagaacggaacatc
ttagaggaagtcaagcatcctttcatcgttgatctaatctatgcctttcagacgggcggc
aagctttacctcatccttgaatacctaagtggtggggagcttttcatgcagctggagcga
gagggaattttcatggaagacacggcctgcttttacctggctgaaatctctatggcgctc
ggacacctgcatcagaaaggcatcatctacagagatctcaaacctgagaacatcatgctg
aacaaccaaggacatgtaaaactgactgatttcgggctgtgtaaggagtccattcatgac
ggcacagtgacccacactttctgcggcaccattgagtacatggctccagagatcctcatg
aggagcggacacaatcgcgctgtcgactggtggagtctgggggctttaatgtatgacatg
ttaaccggagcacctccttttacaggagagaaccggaaaaaaaccattgacaaaattctt
aaatgcaaactgaacctcccaccctacctcacacaagaagccagggaccttctcaaaagg
ctactgaaaagaagtgcctcatctcggcttggggctggacctggagatgcaacagaagta
cagactcatccctttttccgacatgttaattgggatgatcttcttgcacgcaaagtagaa
ccaccattcaagcctttcttgcaatttgctgaggatgtgagccagtttgattcaaagttc
accagccagactcccgttgacagtcctgatgactccacactgagcgaaagtgcaaatcag
gtctttttgggttttacttatgtagctccatccgtattggaaaatataaaggagaagttc
tcatttgagccaaaaatccgttcacctcgccggttcttgggaagcccccgaacgcctctc
agtccaattaagttctcaggagattgttggccacgaggtcccaccttacccggatcctcc
accctccagtcccccacagagctggccatggaagtgtccagcgtggatcacatggatgtc
caggccagtgccgaagccaccgctcctcttcccatcaggcaacccgctggctcaaacatg
ggccagttcaagcagcaggcctaccccgtcatctccaaaaggccagagcatctacgtatg
aacctatga

KEGG   Danio rerio (zebrafish): 562242
Entry
562242            CDS       T01004                                 

Gene name
rps6kb1a
Definition
(RefSeq) ribosomal protein S6 kinase beta-1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04350  TGF-beta signaling pathway
dre04371  Apelin signaling pathway
dre04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    562242 (rps6kb1a)
   04350 TGF-beta signaling pathway
    562242 (rps6kb1a)
   04371 Apelin signaling pathway
    562242 (rps6kb1a)
   04150 mTOR signaling pathway
    562242 (rps6kb1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    562242 (rps6kb1a)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    562242 (rps6kb1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    562242 (rps6kb1a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     562242 (rps6kb1a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   562242 (rps6kb1a)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7
Other DBs
NCBI-GeneID: 562242
NCBI-ProteinID: XP_021327969
ZFIN: ZDB-GENE-091113-52
Ensembl: ENSDARG00000018399
Vega: OTTDARG00000031079
LinkDB
Position
10
AA seq 506 aa
MAGVFDIDLDPPEDNVSDEELSDGAKINEYIDQCSGFEFMEDCEKFEISEDSVNQGTEKI
RPECFELLRVLGKGGYGKVFQVRKVAGAASGKIFAMKVLKKAMIVRNAKDTAHTKAERSI
LEEVKHPFIVDLIYAFQTGEKLYLILEYLSGGELFMQLEREGIFLEDTACFYLAEISLAL
GHLHQKGIIYRDLKPENIMLNYNGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILT
RSGHNRAVDWWSLGALMYDMLTGAPPFTAENRKKTIDKILKCKLNLPPYLTQEARDLLKK
LLKRNASVRIGASPRDVLDIQRHSFFRHINWDDLLAFKIDPPFKPFLQSADDVSQFDSKF
TSQTPVDSPDDTKLSESDNQVFLGFTYIAPSVLENIKEKFTFEPKSRSPRKVLGSPRTPV
SPLKAEVEDGWSRGPLFPEVTTSSSLLPPTGALKQASNVEQMDMSSNMEASAPLPIKKPL
GSNTGSFMKQPHPVGGRRPKHLKMKL
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggctggggtgtttgatatcgatttggacccgccggaggacaacgtgtcagatgaggag
ctctccgacggggccaagattaatgaatatatagaccagtgcagcggttttgagtttatg
gaagattgtgaaaagtttgagatctctgaagacagcgtaaatcaaggaactgagaagatt
cgtccagagtgttttgagttgcttcgtgttttgggtaaaggtggatatggaaaggttttc
caagttcgcaaggttgccggggcagcttctgggaagatatttgccatgaaggtcttgaag
aaggccatgattgtacgcaatgcaaaagacactgctcacactaaagcagaaaggagcatc
ctggaggaagttaagcatcccttcattgtggaccttatatatgcctttcagacaggagaa
aaactttatctcatcctggagtacctcagtggtggagagctgttcatgcagctggagaga
gagggaatcttcttggaggacacggcctgcttttacctggcagagatttccctggcctta
ggtcaccttcatcagaagggcatcatctacagggatcttaaaccagagaacatcatgcta
aattacaacggtcatgtcaagctgacagacttcggactttgtaaggagtcgatccacgat
ggtaccgtcacacacaccttctgtggaaccatagagtacatggcaccagaaatcctcacc
agaagtggccataaccgagctgtggactggtggagcctgggagctctgatgtatgacatg
ctaacaggagctccgccgttcacagcggagaatcggaaaaagaccattgacaaaatcctg
aagtgcaaactaaaccttccaccgtacctcacccaagaggctcgagacctcctcaaaaag
ttgctgaagagaaatgcatcggtacggattggagcaagtcctagagatgttctagacatc
cagcgccactctttcttcagacacataaactgggatgatctgctggcattcaaaattgat
cctccattcaaaccctttttgcaatccgcagatgatgttagccagtttgactcaaagttc
actagtcagactcccgtggacagccctgatgacacgaagctcagtgaaagcgacaaccaa
gtcttcctgggctttacatacatagctccatctgtgctggaaaacatcaaagaaaagttc
acttttgagccaaaatcccggtcacctcgcaaggttctgggaagcccaagaacaccagtg
agcccgttgaaggctgaagttgaagacggttggtctcgaggtccacttttcccagaagtg
accacctcctcctctctcctgccgcccactggtgcactaaagcaggcgtctaatgtggag
cagatggacatgagcagcaacatggaggcctcggccccgctccctatcaaaaaaccactg
ggttccaacacaggatccttcatgaaacaacctcatccagtgggcggcagaagacccaag
catttgaagatgaagctttga

DBGET integrated database retrieval system