KEGG   Danio rerio (zebrafish): 406666
Entry
406666            CDS       T01004                                 

Gene name
gab1
Definition
(RefSeq) GRB2-associated-binding protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    406666 (gab1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    406666 (gab1)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   406666 (gab1)
SSDB
Motif
Pfam: PH PH_11 PH_13 PH_9 zf-piccolo
Other DBs
NCBI-GeneID: 406666
NCBI-ProteinID: NP_001313642
ZFIN: ZDB-GENE-040426-2674
Ensembl: ENSDARG00000037018
Vega: OTTDARG00000021766
UniProt: F1Q7S5
LinkDB
Position
1
AA seq 740 aa
MSGGDVVYSGWLRKSPPEKKLRRYAWKKRWFVLRSGRLSGDPDVLEYYKNDHAKKPIRVI
DLNLCEQVDAGLSFNKKDLEHSFIFDIKTIDRIFYLVAETEEDMNKWVRNICEICGFNPT
DTEDSAKVSHHVNVPGGLVVDMAPSGGLGGALGASALANLPPPYQPVSIRQLGSSSSLDE
PQDYLWLLNCESKKPEPNRAHGDCSKSTSSEPDCNDNLPSHYTPTSSTSKNAPVNGFFST
QHPTGLYDSPPLRGQSLSADSQGLYHLPRSYSQDTVLLPKSATSPPIPDGEPGELYVFNT
PGRKPSLEAHLRNLSVSYDIPPTPGSNSTYQVPRTAGVEAVSGSTEVIPPPRPPKPSVSG
GSVPPERSPTDTYVVPRSVSETDTNYCVPTSAGGNKALRSNTIGTVDSSRLRKDYGSQDC
YDIPRPFPSEKSCSFDFNESFNNYFKNKGMVPVGGVSTEEMDENYVPMSVHSLSHQRSGS
LSEPIQEPNYVPMTPGTVEFSSLGKQVPPPAHMGFRSSPKTPPRRPIPISECQPPPIDRN
LKPDRKGQSPKINRAVGLERTDSQTIGEFSRRRKVKPAPLEIKPVSEWEEYTAPVRSPVT
RSFTRDPSRFTVAPRPSSGQSTASSSDSDECDENYVTMQANMSSDEPNKLGAPMNADGGG
SPMVKPKGDKQVEYLDLDLDPGKSTPPRKKKNNGTGISASDERVDYVLVDQQRTQALKST
REAWSDGRQSTEDTPTKGAK
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgagcggaggagatgtggtttactcggggtggctccgaaagtctccacctgaaaaaaag
ttacggcgttatgcatggaagaagcgatggtttgttctgcgcagtgggaggctgtctgga
gacccagacgtgctggagtattacaagaatgaccatgccaagaagcccatccgcgttatc
gatctgaacctgtgcgagcaggtggacgccggtctctccttcaacaagaaggacctggag
cacagcttcatctttgacatcaagactatcgacaggatcttttacctggtggcagaaact
gaagaagatatgaacaagtgggtgcgcaacatctgtgaaatctgtggcttcaaccccacc
gatacagaagactctgcaaaggtctctcatcatgtaaatgtgccaggcggtctggtggtg
gatatggcccctagtggagggctgggcggagctttaggggcgtctgcattagccaacctg
cctcctccctaccagcccgtcagcatcagacagctgggatcatcctccagtctagatgag
cctcaggactacctttggctgctcaactgtgagagcaaaaaacctgagcctaacagggct
catggcgactgctccaagtctacctcctctgaacctgactgtaatgacaaccttccttcc
cactacacacccacctcctccacctccaaaaacgccccggtcaatggtttcttttccacc
caacatcccactgggctctacgattctcctcctttgcgcgggcagtcattgtcggccgac
tcacagggcctgtaccacctgccccgaagttactctcaggacactgtgctgctgccgaag
tcggcgacctcccctcccattcctgacggtgaacctggtgaactctatgtctttaacaca
cctggtcggaaaccctcattagaggcccatttgcggaacttgtcagttagctatgatatt
ccacctacacctggcagcaattccacctaccaggttccccgaacagcaggagtggaggct
gtttcagggtccacagaggtaattccaccaccacgtccaccaaagccttcagtgagtggg
ggatcagtcccacctgagcgatcgcctacagacacttatgtggtaccgcggtcagtgtct
gagactgatacgaattactgtgttccgacaagtgcaggaggcaacaaagcactcagaagc
aacaccattggtacggtggattcttcacgtctgcgtaaagattacggatctcaagactgc
tatgatataccccggcccttcccttcagaaaaaagttgctcgtttgattttaatgaaagt
ttcaacaactattttaaaaataaaggcatggtgccagtaggaggtgtttctacagaggaa
atggatgaaaactatgttcccatgagcgtccactctttgtcacatcagcgctccggcagc
ctatcagaacctatacaggagcccaactacgtccccatgacaccaggcacagtggagttc
tcttcccttggaaaacaggtgccccctccagcccacatgggcttcaggtccagtcccaag
acaccaccccgtagaccgattcctatatctgaatgccaacctccacccatagaccgcaac
ctcaaacctgaccgtaaaggtcagagccctaaaataaacagagcagtcggtcttgagcgg
accgactcccaaaccataggtgaattctcaagacggcgtaaggttaagccagcccctttg
gaaatcaagcctgtatctgaatgggaggagtatacagcaccggttcgatcgcccgtcacc
aggtccttcacgagggacccttctaggtttactgtggcccccagaccgtcctcggggcaa
agcactgcctccagcagcgactcggacgagtgtgatgagaattatgtaaccatgcaggct
aatatgtcttcagatgaaccaaacaagttaggagcaccaatgaatgctgatggaggtggc
agtcccatggtgaaacccaaaggagacaagcaggtggagtacctggacctcgacttggac
cctgggaaatcaactccacctcgaaagaagaagaataacgggactggtatttctgcatca
gatgagcgtgtagactatgtgctggtggatcagcagcgaacgcaagcactgaaaagcacc
cgggaggcctggagtgatggacggcagtcgacagaggacacccccaccaaaggggccaaa
tga

DBGET integrated database retrieval system