KEGG   Danio rerio (zebrafish): 406791Help
Entry
406791            CDS       T01004                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00051  Fructose and mannose metabolism
dre00052  Galactose metabolism
dre00500  Starch and sucrose metabolism
dre00520  Amino sugar and nucleotide sugar metabolism
dre00524  Neomycin, kanamycin and gentamicin biosynthesis
dre01100  Metabolic pathways
dre01200  Carbon metabolism
dre04910  Insulin signaling pathway
Module
dre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dre_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    406791 (hk1)
   00051 Fructose and mannose metabolism
    406791 (hk1)
   00052 Galactose metabolism
    406791 (hk1)
   00500 Starch and sucrose metabolism
    406791 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    406791 (hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    406791 (hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    406791 (hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    406791 (hk1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     406791 (hk1)
Membrane trafficking [BR:dre04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    406791 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 406791
NCBI-ProteinID: NP_998417
ZFIN: ZDB-GENE-040426-2848
Ensembl: ENSDARG00000039452
Vega: OTTDARG00000022817
UniProt: Q7ZUM3
LinkDB All DBs
Position
13
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRFSDETLRDIMARFRREMENGLARDTNPTAT
AKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIIH
GSRSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCSQSKLDEAVLLTWTKRFKVNGV
EGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHMDMVEGDEGRMCINTEWGAFGDDGTLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKAKEILTRLG
VEPSEDDCIAVQHVCAIVSFRSANLIAATLGAILTRLKDNKNTPRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPESDVRFLLSESGSGKGAALVTAWAYRLADQERQIAETLEEFRLT
KDQLLEVKKRMRTEIQNGLSKSTQNTATVKMLPTYVRSTPDGSENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVYCISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGLLVNWTKGFKATDCEGEDVVGLLREGIKRREEFDLDVVAIVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIETVSGEEGRMCVNMEWGAFGDNGCLDD
IRTKYDDAVDDLSLNAGKQKYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGAVSRRAAQLCGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELAPKCNVTFLLSEDGSGKG
AALITAVGCRLRQQEQKS
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggcacagcttctggcctactacttcactgaactgaaggatgaccaggtcaaa
aagattgacaaatacttgtacgccatgcggttctctgacgagacgctgcgcgatattatg
gctcgtttccgacgggaaatggagaacggattggcacgagacaccaacccgacagccacc
gctaaaatgctgcccacctttgtaaggtccattcctgatggatcagagaaaggagatttc
atcgcactggatctgggtggctctaatttccgtattctgcgtgtaaaagtgtctcatgag
aagaaacagacagtgcagatggaaagtcagatttacgagactccagaagacatcatccac
ggcagcagatcacggttgtttgaccatgttgcagaatgtcttggagacttcatggagaaa
caaaaaattaaagacaagaagcttcctgtgggcttcaccttctcatttccttgttcacaa
agcaaactggatgaggctgttttgctgacatggacgaaacgcttcaaggttaatggagta
gagggaatggatgtagtgaagcttctcaataaggccattaaaaaacgtggagattacgaa
gcagatataatggctgttgtcaatgacactgttggaactatgatgacctgcggatttgat
gaccagcgatgtgaagtcggcattatcataggtaccggcactaatgcatgctacatggag
gagctcagacacatggacatggtggagggagatgaaggcaggatgtgtattaatactgaa
tggggggcgtttggagatgacggcacattggaggacatccggactgagtttgacagggag
attgaccgaggatccctcaaccctggcaagcaactgtttgagaagatggtgagtgggatg
tacatgggtgagctggtgaggctgatcctggtcaaaatggctaaagaaggcctgctgttt
gaaggccgcatcacaccagagctgcttacaaaaggaaaaatcgaaaccaagcacgtttct
gcaattgagaagagcaaggaaggactaaccaaagccaaggagattttgacacgcttgggt
gtagagccgtctgaggacgactgcattgctgtgcagcatgtttgtgccattgtctctttt
cgctctgctaatctaattgctgccactttgggtgcaatcctgacacgtctgaaggacaac
aagaacaccccacgtctccgcaccaccgtgggcattgatggctccctatacaagatgcac
ccacagtatgcccgtcggttgcacaaaacagtgcgtcgtctggtgccagagtctgatgtt
cgcttcttgctgtctgagagtggaagtggaaagggagctgcactggtgacagcctgggct
taccgtttggcggaccaggagcgtcaaattgcagaaaccctggaagagttcaggttgacc
aaagaccagctgctagaggtgaaaaagaggatgagaactgagattcagaatggactgagc
aagagcacccaaaacacagccaccgtcaaaatgctgcccacatatgtgcggagtacccct
gatggatcagaaaacggtgactttttggctctggatcttggaggtacaaacttcagggtc
cttttggtaaagattcgcagtggcaagagacgaactgtggagatgcataataaaatttat
gccattcccatagaagtaatgcaaggaaccggagaggagctttttgatcacatcgtgtac
tgcatatctgacttcctggactacatgggaatgaagaatgcccgtctgcctctgggcttt
accttttctttcccctgcagacaaactagtcttgatgcgggactcttggtgaattggacg
aagggctttaaagccacagactgtgaaggtgaagatgttgtcggccttctgagagagggg
atcaagaggagagaggagtttgatttggatgttgtagccatagtaaatgacacagtgggc
acaatgatgacctgcgcatatgaagagcccacgtgtgaggttgggctaatcgcaggaacg
ggcagcaatgcctgctacatggaggaaatgcgaaacatcgagacagtaagtggagaggag
ggcaggatgtgtgtgaatatggagtggggagcatttggagataatggctgtctggatgac
atccggacgaagtatgacgatgctgtggatgacctctccctcaatgccggcaaacaaaag
tatgagaagatgtgcagtggcatgtacctgggtgagattgttcgaaacatcttgatcgac
ttgacgaagcgaggcttcctcttcaggggacagatctctgaaacactgaagaccagaggc
atcttcgaaaccaagttcctgtcccaaattgagagtgaccgtttggcgctactgcaggtc
aggtctattctccagcatctgggtctggacagcacatgcgatgacagtatcatcgtcaag
gaggtttgtggagctgtttctcgtcgagcagctcagctctgtggagcaggaatggctgct
gttgtggataaaatccgggagaaccgtggactggatcatctggacatcactgttggagtg
gatggcaccctgtataagctccatccacatttctctaggataatgcatcagacggtgaag
gagctcgcccccaaatgcaacgtcactttccttctctcagaagacggaagcggtaaaggt
gctgccttgatcaccgccgttgggtgtcgcctccgccagcaagaacagaagagctga

DBGET integrated database retrieval system