KEGG   Danio rerio (zebrafish): 407664
Entry
407664            CDS       T01004                                 

Gene name
hbegfb
Definition
(RefSeq) heparin-binding EGF-like growth factor b precursor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    407664 (hbegfb)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    407664 (hbegfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    407664 (hbegfb)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   407664 (hbegfb)
SSDB
Motif
Pfam: Chordopox_A33R CD34_antigen EGF LRR19-TM
Other DBs
NCBI-GeneID: 407664
NCBI-ProteinID: NP_001093871
ZFIN: ZDB-GENE-070820-6
Ensembl: ENSDARG00000031246
Vega: OTTDARG00000028362
LinkDB
Position
21
AA seq 232 aa
MSWTIPKKRKMETFRIMFCLVLLKVCSGASLDRFESGKPRTTEVNLLHTSEKTNITGLQA
DNGTSVGDDDYEEDYEGDYELNLPRVAFSTKPKHPSAMPTTEKTKKRKRKGKGKGRGNKK
NLCEEEYKDFCIHGVCHYQRDLRTHSCVCHGGYSGERCHVFTLPVGKEEQRYSRTTALAV
IAVVLSLMCLAVIAILLALRYSACFSDRYHKKDDADVESEEKVKLEATSVKQ
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtcttggactatcccaaagaaaaggaagatggaaacatttcgaattatgttttgtctc
gtgttactcaaggtgtgcagtggcgcctctctggacaggtttgagagtggaaaacccagg
acaacagaggtcaacctgcttcacacctcagagaaaacaaacataacagggctccaggcg
gacaacgggaccagtgtgggtgatgatgactatgaagaagattatgaaggggattatgag
ctaaacctgccaagagtggcattttccaccaaacccaaacatccgtcggcgatgcccact
actgagaagacaaaaaaaagaaaaaggaagggcaaaggaaaaggcagggggaataagaag
aacctctgcgaggaggaatacaaagatttctgcattcatggagtgtgtcattatcagcgg
gatttacgcactcattcttgtgtatgtcatggaggatactctggagagagatgtcacgta
ttcaccctgccggtggggaaggaggagcagcgttacagccgaaccacagcgctggcggtc
atagcagtggttctgtccctcatgtgtctcgcagtcatcgctattctgctggcattaaga
tattctgcatgcttttctgacaggtaccacaaaaaagatgacgctgatgtagagagcgaa
gaaaaggtcaaactcgaggcaacgtcagtaaaacagtga

KEGG   Danio rerio (zebrafish): 797938
Entry
797938            CDS       T01004                                 

Gene name
hbegfa
Definition
(RefSeq) heparin-binding EGF-like growth factor a precursor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    797938 (hbegfa)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    797938 (hbegfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    797938 (hbegfa)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   797938 (hbegfa)
SSDB
Motif
Pfam: EGF hEGF
Other DBs
NCBI-GeneID: 797938
NCBI-ProteinID: NP_001104696
ZFIN: ZDB-GENE-080204-119
Ensembl: ENSDARG00000075121
Vega: OTTDARG00000034934
UniProt: A9JRW9
LinkDB
Position
14
AA seq 230 aa
MNFLTVLRLFVFTIVAVRGASIPLVFESERPAQTAVIDLLEALSEKRSTVDNKLVEYEEE
DEEYYYDDDVEEDEEDEFSGDYGLPIVAFSSQPKDPSAVLNAEKLEGSKRKGLGRKKGKG
KGKGKKRNPCLKKYKDFCIHGTCQYFRDLKGPSCICDQGYSGERCHDFSLPVKTNDGGYD
RTTALAVVAVVLSSLCLTIIGLLLALRFHKQGAYNVENEEKIKLGAAPHH
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaactttttaacagtcttgcgtcttttcgtctttaccatcgtggctgtgagaggtgca
tctataccgcttgtgtttgagagcgagaggcctgcgcagacagctgtgattgatttattg
gaggcgctgagtgagaaaagatctaccgtggacaacaagcttgtggaatatgaggaggag
gatgaagagtattactatgatgatgatgttgaagaagacgaggaggatgagttctctggg
gattatgggttgccgatagttgcattttcaagtcaacccaaagacccaagtgcggttttg
aacgcggagaaacttgaaggctcaaagaggaaggggctcgggagaaagaagggaaaagga
aagggaaaaggcaagaaaagaaacccctgtctaaaaaagtacaaggacttttgcatccac
ggaacctgccagtactttagggatttaaaggggccctcatgcatatgtgaccaggggtac
tcaggagagcgatgtcacgatttctctctgccggtgaagacgaatgacggagggtatgac
cgcactacagcccttgctgtggtagctgtggttctctcttcattatgtctgaccatcatt
ggcctcctcctggcactcaggtttcacaagcaaggtgcatataatgtggaaaatgaggag
aagattaaactgggagccgctccacaccactaa

DBGET integrated database retrieval system