KEGG   Danio rerio (zebrafish): 415099
Entry
415099            CDS       T01004                                 

Gene name
rela
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04137  Mitophagy - animal
dre04210  Apoptosis
dre04218  Cellular senescence
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04623  Cytosolic DNA-sensing pathway
dre04625  C-type lectin receptor signaling pathway
dre04920  Adipocytokine signaling pathway
dre05132  Salmonella infection
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    415099 (rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    415099 (rela)
  09143 Cell growth and death
   04210 Apoptosis
    415099 (rela)
   04218 Cellular senescence
    415099 (rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    415099 (rela)
   04621 NOD-like receptor signaling pathway
    415099 (rela)
   04622 RIG-I-like receptor signaling pathway
    415099 (rela)
   04623 Cytosolic DNA-sensing pathway
    415099 (rela)
   04625 C-type lectin receptor signaling pathway
    415099 (rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    415099 (rela)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    415099 (rela)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    415099 (rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    415099 (rela)
Transcription factors [BR:dre03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    415099 (rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 415099
NCBI-ProteinID: NP_001001839
ZFIN: ZDB-GENE-040825-4
Ensembl: ENSDARG00000098696
Vega: OTTDARG00000040348
UniProt: B3DHW2
LinkDB
Position
13
AA seq 455 aa
MDGMFHQWGTSQVPQGPPHVEIIEQPKSRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPAI
RVHNYSGPVRVRISLVTKNQPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQCVK
KKDVGEAVSCRLQTQNNPFKIPDAKIWEEEFDLNAVRLCFQVSITLSSGDLFPLEPVVSQ
PIYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFLDSWESKGSFSQ
ADVHRQVAIVFRTPPYCDTNLTEPLRVKMQLRRPSDREVSEPMDFQYLPSDPDEHRLMEK
RKRTEGMLHNLKLSSIITGSSMSAERRPFPTAKRTLPVSKQPVAASAPASVPAVSAAPPL
KPPPTSFFSPPPGQLFTQQKMEPSPLPASSSDIWKYLQAMSVDSQPKAVPVLPFPSGTVS
TGRDARLITAARGENTVLHPYTLHYTHLTHVLLLV
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggacggaatgtttcaccagtggggaacttcgcaggtgcctcaaggtcctccacatgtg
gagatcatcgagcagcctaaatctcgagggatgcgtttccgttataagtgtgagggtcga
tcggccggcagcatccctggagagaagagcaacgacaccacgaaaacgcaccccgccatt
agggttcacaactacagtgggccagtcagagtgcggatctccttggtaaccaagaatcag
ccgtataagccacacccacacgagctggtgggaaaagactgtaaacatggctactatgag
gcagatctgcaggagcgcaggatacacagtttccagaatctgggtattcagtgtgtgaag
aagaaggatgtgggagaagctgtttcctgcagactgcagacgcaaaacaacccattcaag
attcctgacgcaaagatctgggaggaggagttcgacctgaacgcggtgcgtctgtgtttc
caggtctccatcaccctgagcagcggagatctgttccctctggagcccgtcgtctctcag
ccgatatacgacaacagagctcctaacactgctgagctgaagatctgccgtgtcaataga
aactccggcagctgtcgaggaggagacgagattttcctgctgtgtgataaagtacagaaa
gaggacattgaggtgcgcttcttcctggactcgtgggagagtaagggctcgttctctcag
gctgatgtgcaccggcaggtggcgatagtgttccgcacgccgccctactgcgacactaac
ctgaccgagccgctgcgtgtcaagatgcagctgcgcagaccatctgaccgcgaggtcagc
gagcccatggacttccagtacctgccctcagacccggatgagcaccggctgatggagaag
cgcaagagaactgaaggaatgctgcataatctcaagctgagcagtatcatcacagggtcc
tcgatgtctgctgaaagacggccattccctacggctaaacgaactctacctgtctccaaa
cagccagtggcagccagtgcaccagccagtgtaccagcagtgtccgccgctcctccactg
aagcctccacccacctcctttttctctccgccccccggtcagctcttcacccagcaaaag
atggagccctcacccttgccggcatcctcctcagacatctggaagtatctgcaggccatg
tcagtggacagccagcccaaagcggtgccggtgctgccctttcccagtggaaccgtttcc
accggtagggatgcaaggctgataacagcagccaggggagagaatactgtcctgcacccg
tacacactgcattacacacacctcacacacgtgctcttattagtgtaa

DBGET integrated database retrieval system