KEGG   Danio rerio (zebrafish): 431718Help
Entry
431718            CDS       T01004                                 

Gene name
hdac11
Definition
(RefSeq) histone deacetylase 11
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    431718 (hdac11)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     431718 (hdac11)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     431718 (hdac11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 431718
NCBI-ProteinID: NP_001002171
ZFIN: ZDB-GENE-040704-7
Ensembl: ENSDARG00000087573
UniProt: Q6GMJ4
LinkDB All DBs
Position
11
AA seq 366 aa AA seqDB search
MSKKEDSGGKKCSHHTELYAEVPASCLPIVYSPEYNITFMGLEKLHPFDAGKWGKVIRFL
KEEQFITDEIIVLAREASEADLLVVHTARYLNRLKWSLVVATITEIPPLLFLPNFLVQRK
VLRPLRTQTGGTIMAGKLAIDRGWAINVGGGFHHCSSDKGGGFCAYADITLAIKFLFERV
EGVASATIIDLDAHQGNGHERDFLEDRRVYIMDVYNRHIYPGDGYAKRAIKRKVELDWGT
EDSEYLQKVDLHSEGALNEARPDIIIYNAGTDILDGDPLGGLAISPQGIIKRDEIIFRAA
RRRGIPILMVTSGGYQKKTARIIADSILNLHRQGLIGEEALDVAGPSHVSLMMSKSVSSG
ATLAAI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagaaagaagattcaggaggaaagaaatgttcccaccacacagaactttacgca
gaggtccctgcgtcatgcctgcccattgtatattccccagagtacaacatcaccttcatg
ggcctggaaaagctgcatccctttgacgctggcaagtggggaaaggtcattcgcttcttg
aaagaagagcagttcatcaccgatgagatcattgttctggctcgggaagccagcgaggcg
gatcttcttgtggttcacacggcacggtacctgaacagacttaagtggtctctggtggtt
gccactatcacagaaatcccacctctcctgtttctgcctaacttcctggtacagcgcaaa
gtgctgagaccattacgaacgcaaacaggaggaaccatcatggccggaaagctggcaata
gatcgaggatgggcaataaatgttggaggaggcttccatcactgctcaagtgacaaagga
ggaggtttttgtgcctatgctgatatcacacttgctatcaagtttctctttgagagggtt
gagggagttgccagtgccaccatcattgatctggacgcccatcagggaaacggccacgag
cgggatttcctggaagacagacgcgtttacataatggatgtctataatcgccacatctat
ccaggagatggatatgcaaagagggcgattaaacggaaagtggagctggactggggaacc
gaagacagtgaatatctacagaaggtggatctccattcagaaggggcactgaatgaagca
cggcctgacattatcatatacaacgcaggaacagacatccttgatggagatcctctcggg
ggcctggctatttccccacagggtatcataaagagggatgagatcatcttcagggcggcc
cggaggcgaggaatccccatcctaatggtgacgtcaggaggctaccagaagaaaacggcc
cgtatcatcgctgactccatcctcaatctccacagacagggtttgattggtgaagaggct
ctagatgttgcgggaccctcacacgtgtcacttatgatgagtaaatctgtgtcatcaggg
gctacgcttgctgccatttaa

DBGET integrated database retrieval system