KEGG   Danio rerio (zebrafish): 436815
Entry
436815            CDS       T01004                                 

Gene name
camk2d2
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta 2 chain
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04114  Oocyte meiosis
dre04217  Necroptosis
dre04261  Adrenergic signaling in cardiomyocytes
dre04310  Wnt signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    436815 (camk2d2)
   04310 Wnt signaling pathway
    436815 (camk2d2)
   04020 Calcium signaling pathway
    436815 (camk2d2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    436815 (camk2d2)
   04217 Necroptosis
    436815 (camk2d2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    436815 (camk2d2)
   04916 Melanogenesis
    436815 (camk2d2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    436815 (camk2d2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    436815 (camk2d2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     436815 (camk2d2)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   436815 (camk2d2)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Kdo Pkinase_fungal FTA2 SnoaL_2 Mltc_N PAF-AH_p_II RIO1
Other DBs
NCBI-GeneID: 436815
NCBI-ProteinID: NP_001002542
ZFIN: ZDB-GENE-040718-277
Ensembl: ENSDARG00000014273
UniProt: Q6DGS3
LinkDB
Position
1
AA seq 493 aa
MALTICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQIL
ESVHHCHVNGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEAPKHPWICQRSTVASMMHRQETVECLKKFNARRKLK
GAILTTLLVTRNFSAAKSLLNKKPDGVKEPQTTVIHNPVDRNKESTESANTTIEDEDLKA
RKQEIIKVTEQLIESINNGDFEAYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSK
GNKPVHTILLNPHVHLIGEDAACIAYIRLTQYMDGSGMPRTMQSEETRVWHRRDGKWLNI
HFHRSGAPSVPIN
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggctctgaccatctgcaccagattcacggacgaatatcagctttttgaggagctcgga
aagggtgcgttctctgtcgtgaggcgatgcgtgaagatatcatccggccaagagtatgcg
gccaaaatcatcaacacaaagaagctgtccgccagggatcaccagaagctggagagagag
gccaggatttgtcgtctcttgaaacatccgaatattgttcgactgcatgacagcatatcg
gaggagggcttccattacctcgtttttgatctggtgactggaggtgaactgttcgaggac
atcgtagcgagagagtattacagcgaggctgatgccagtcactgcattcagcagattttg
gagagtgttcatcactgccatgttaatgggatcgtccacagggacctgaagcctgagaat
ctgctgttggccagtaagatgaagggggcggctgttaagcttgctgactttggtttggcc
attgaggtccagggtgatcagcaggcttggtttggatttgctggtactccagggtatctg
tctccagaggtgctgaggaaagatccttatggcaaaccggtggacatgtgggcttgcggt
gtgatcctctacattctgctggttggatatccgccattttgggatgaagaccagcatcgc
ctctatcagcagatcaaggctggtgcctatgattttccttctcccgagtgggacaccgtg
acccctgaagctaaagatctgattaataagatgttgactatcaatccctctaaacgtatc
acagctgctgaagcccccaaacacccctggatctgccaacgctccactgtagcctcaatg
atgcacagacaggaaaccgtggagtgcttgaagaaattcaacgccagaaggaaactcaag
ggtgcaattctgaccactctcctggtcacaagaaacttctcagcagccaaaagcttgttg
aacaagaagccagatggtgtgaaggagccacaaactaccgtgatccacaacccagtggac
agaaacaaggagtctacagagagtgccaacacaactattgaggatgaagaccttaaagct
cgaaagcaggagatcataaaggtgacagagcagctgattgaatccatcaacaacggcgac
tttgaggcttatgcaaagatttgcgatcctggtcttacttcctttgagcctgaagctttg
ggaaacctggtggaggggcatgatttccacaggttctactttgaaaacgcgctgtccaaa
ggtaacaaacctgtacacactatccttctgaaccctcatgtgcacctgattggggaggat
gcggcctgtatcgcgtacatccgcttgacccagtacatggatggcagcgggatgccacgc
accatgcagtcggaggagactcgtgtctggcaccgtcgagatggcaagtggctgaacatc
cactttcatcgctctggagcccccagtgtgcccatcaattaa

KEGG   Danio rerio (zebrafish): 445208
Entry
445208            CDS       T01004                                 

Gene name
camk2d1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta 1 chain isoform 1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04114  Oocyte meiosis
dre04217  Necroptosis
dre04261  Adrenergic signaling in cardiomyocytes
dre04310  Wnt signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    445208 (camk2d1)
   04310 Wnt signaling pathway
    445208 (camk2d1)
   04020 Calcium signaling pathway
    445208 (camk2d1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    445208 (camk2d1)
   04217 Necroptosis
    445208 (camk2d1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    445208 (camk2d1)
   04916 Melanogenesis
    445208 (camk2d1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    445208 (camk2d1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    445208 (camk2d1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     445208 (camk2d1)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   445208 (camk2d1)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 445208
NCBI-ProteinID: NP_001108180
ZFIN: ZDB-GENE-040801-121
Ensembl: ENSDARG00000043010
Vega: OTTDARG00000022282
UniProt: Q6DEH3
LinkDB
Position
7
AA seq 491 aa
MASTTCTRFTDEYQLYEELGKGAFSVVRRCMKISTGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHANIVRLHDSISEEGVHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL
SPEVLRKEPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPAKRITAAEALKHPWICQRSTVASMMHRQETVECLKKFNARRKLK
GAILTTMLATRNFSSKNPYKKPDGVKEPQTTVIHNPTDGNKESSESTNTTIEDEDIKARK
QEIIKVTELLIEAINNGEFEAYTKICDPGLTSFEPEALGNLVEGTDFHRFYFENSLSKGH
KPIHTILLNPHVHLIGEDAACIAYIRLTQYMDVNNMPRTMQSEETRVWHRRDGKWQNIHF
HRSGSPTVPTK
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggcttcaacaacctgcaccaggtttaccgacgaatatcagctgtatgaagaactggga
aaaggagcgttttctgtggtgagaagatgtatgaaaatctccactggtcaggagtacgct
gccaaaatcatcaacaccaaaaagctgtctgccagggatcaccaaaaactggaacgagag
gccagaatttgtcgtctactcaagcatgctaatattgtgaggctccatgacagcatatca
gaggagggtgttcactaccttgtctttgatttagtcacaggaggggagctatttgaagac
attgttgccagggaatactacagtgaggctgatgccagtcattgcattcagcagattctc
gaggccgttctccactgccaccagatgggagtggtccatcgtgacctgaagccagagaat
cttctcttagccagcaaactaaagggtgcagcagtgaaactggctgattttggcctggct
atcgaggtacagggagaccagcaagcatggtttgggtttgctggaactccaggttatctg
tctcctgaggtgctgaggaaggaaccttatggcaaacccgtagacatgtgggcatgcggt
gtgattctttacatccttcttgtgggttaccctcctttctgggatgaagaccaacatcga
ctttaccaacagatcaaagctggtgcatatgattttccctctcctgagtgggacacagtg
acaccagaggccaaagatctgattaacaagatgctgacgataaaccctgccaaacgcatt
accgcagctgaggcactcaaacacccctggatctgtcaacgttccacagtggcttccatg
atgcacagacaggagacggtggaatgtctgaaaaagttcaacgccaggaggaagcttaaa
ggtgctattcttactaccatgcttgccacacggaacttctcaagcaaaaatccatacaag
aaacctgatggtgtcaaggagcctcaaaccactgttatccacaatcccactgatggaaac
aaggaatcatcagagagtaccaacaccactattgaagacgaggacattaaagcacggaaa
caggagatcattaaagtaacagagctgctgattgaagccattaacaatggagaatttgaa
gcgtacacgaaaatttgtgaccctggactgacgtcttttgagcctgaagctttgggaaac
cttgtggaagggacagatttccataggttctactttgaaaactctctgtctaaaggccac
aaacccatccacaccatcttgctgaatcctcatgtgcacctgattggagaagacgccgcg
tgcatcgcttacataagactcacccagtacatggatgtcaacaatatgcctcgcaccatg
cagtctgaggagacgcgtgtctggcatcgtcgtgacggcaagtggcagaacatccacttc
caccgatctggctcaccaactgtgcccaccaagtga

KEGG   Danio rerio (zebrafish): 550436
Entry
550436            CDS       T01004                                 

Gene name
camk2a
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04114  Oocyte meiosis
dre04217  Necroptosis
dre04261  Adrenergic signaling in cardiomyocytes
dre04310  Wnt signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    550436 (camk2a)
   04310 Wnt signaling pathway
    550436 (camk2a)
   04020 Calcium signaling pathway
    550436 (camk2a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    550436 (camk2a)
   04217 Necroptosis
    550436 (camk2a)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    550436 (camk2a)
   04916 Melanogenesis
    550436 (camk2a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    550436 (camk2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    550436 (camk2a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     550436 (camk2a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   550436 (camk2a)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 Pkinase_fungal APH Kdo SnoaL_2
Other DBs
NCBI-GeneID: 550436
NCBI-ProteinID: NP_001017741
ZFIN: ZDB-GENE-051113-72
Ensembl: ENSDARG00000053617
UniProt: Q32PV2
LinkDB
Position
21
AA seq 478 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLSGQEYAAKIINTKKLSTRDHQKLDRE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SLEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVECLKKFNARRKLK
GAILTTMLATRNFSGGKSGVSKKTDGVKESSESTNTTIEDEDTRVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPSVTAFEPEALGNLVEGLDFHRFYFENLWSKNSKPVHTTILNPHIH
LIGEEAACIAYIRITQYLDNNGMPCTAQSEETRIWHRKDGKWQIVHFHRSGSPAAIAK
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcaaccatcacctgcacacgctttacagaggaataccagctgtttgaggaactggga
aagggagccttttctgtggtgcggagatgcgtgaaagttctctcagggcaagagtatgcc
gctaagatcatcaacacaaagaagctgtctactcgggaccaccagaagctggacagggag
gctaggatctgcagattgctgaaacaccccaatattgtgcgtctgcatgacagcatctca
gaggaaggccaccactacctcatctttgacctagtaacgggtggtgagctgtttgaagac
atcgtcgccagggaatattacagtgaagcagatgccagtcactgcattcagcagattttg
gaggctgtacttcattgccatcagatgggtgttgtgcacagagacttaaagccagaaaac
ctgcttctggcttcgaaatccaaaggcgcagctgtgaagttggcagattttggcctcgcc
attgaggttgagggggaacaacaggcctggtttggctttgccggcactcctggatacctg
tcccttgaagtcctccggaaggatccctatgggaaggctgtagacctgtgggcgtgtggt
gtgattctctacattctgctggttggatacccacccttttgggatgaagaccaacacaga
ctctatcagcaaattaaagccggcgcctatgattttccttcacccgagtgggacacagtc
actcctgaggcgaaagatcttattaataagatgctgaccatcaacccgtccaaacgcatc
actgctgcggaggcgctcaaacacccatggatatcacatcgctccaccgtcgcatcttgc
atgcataggcaggagactgttgaatgtttgaagaagttcaacgctagaagaaagcttaag
ggtgctatcctcaccaccatgctggccaccagaaacttctcaggaggaaagagtggcgtc
agcaagaagacggatggtgtgaaggaatcatcagagagcaccaacaccacaattgaagat
gaggatactagagtgaggaagcaggaaatcatcaaagtaaccgagcagctgattgaagcc
atcagcaatggagacttcgagagttacacgaagatgtgtgatcccagcgttacagcgttt
gaacccgaagctctgggaaacctggtggagggtctggacttccatcgcttctactttgaa
aacttgtggtcaaagaacagcaagccggttcacactaccatcctcaaccctcacatccat
ctgatcggcgaggaggccgcctgcatcgcctacattcgcatcacacagtacctagacaat
aacgggatgccctgcactgcccagtccgaagagacacgaatctggcatcgtaaagacggc
aagtggcagatagtccatttccaccgctcgggctctccagctgccatcgctaaataa

KEGG   Danio rerio (zebrafish): 562064
Entry
562064            CDS       T01004                                 

Gene name
camk2b1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase (CaM kinase) II beta 1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04114  Oocyte meiosis
dre04217  Necroptosis
dre04261  Adrenergic signaling in cardiomyocytes
dre04310  Wnt signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    562064 (camk2b1)
   04310 Wnt signaling pathway
    562064 (camk2b1)
   04020 Calcium signaling pathway
    562064 (camk2b1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    562064 (camk2b1)
   04217 Necroptosis
    562064 (camk2b1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    562064 (camk2b1)
   04916 Melanogenesis
    562064 (camk2b1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    562064 (camk2b1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    562064 (camk2b1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     562064 (camk2b1)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   562064 (camk2b1)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo Pkinase_fungal SnoaL_2
Other DBs
NCBI-GeneID: 562064
NCBI-ProteinID: NP_001258322
ZFIN: ZDB-GENE-030131-9588
Ensembl: ENSDARG00000011065
Vega: OTTDARG00000016150
UniProt: E9QDQ2
LinkDB
Position
5
AA seq 531 aa
MATTTCTRFTDEYQLYEELGKGAFSVVRRCVKLSTGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGFHYLLFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKCKNAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL
SPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTV
TPEAKNLINQMLTINPAKRITAQEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLK
GAILTTMLVSRNFSVGSRQTTAPASVTAAAAAVAAAAGTTAGLVEQAKTLLNKKADVKPQ
TNSTKNSIVTSPKGNLPSPALESSDSSNATVEDEEMKARKQEIIKITEQLIEAINNGDFE
AYAKICDPGLTCFEPEALGNLVEGMDFHRFYFENLLSKNSKPIHTTILNPHVHLIGEEAA
CIAYIRLTQYVDGQGRPRSSQSEETRVWHRRDSKWQNVHFHCSGAPAAPLQ
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggccacgactacatgtacgcgcttcacggacgaatatcagctgtacgaggagctgggc
aagggagccttttcagtggtgcgacgatgtgtaaagttgagcacaggacaagaatatgcc
gccaaaatcatcaacaccaaaaaactgtccgcaagagatcatcagaagctggaacgagaa
gctcgaatctgtcgtttgctgaaacaccctaacatcgtccgtctgcatgacagtatatca
gaggagggcttccactacctactctttgatttggtaactggaggggaactgtttgaggac
atcgtggccagagagtattacagtgaagcagacgccagtcactgcatccagcagatcctg
gaggcggtgcttcactgccatcaaatgggtgtggtgcaccgagacctgaagccagagaat
ctgctcttggccagtaaatgcaagaacgctgctgtgaagctggccgactttggactggcc
attgaggtgcagggagaccagcaggcatggtttggatttgccgggacaccaggttacctg
tcccccgaggtgctgagaaaggaggcatatggcaaaccagtggacatctgggcctgtggt
gtgattctgtacattctgctggttggatatccacctttctgggacgaggatcagcacaaa
ctttaccaacagatcaaagctggagcttacgattttccatctccagaatgggacacagtt
actcctgaagccaaaaacctcatcaatcaaatgctgaccatcaaccctgccaagagaatt
actgcacaggaagctctcaaacacccatgggtctgccaacgctccactgtggcctccatg
atgcacagacaggagacagtggaatgcctgaagaagtttaacgccaggaggaaactcaag
ggcgccatcctcaccaccatgcttgtgtcacgaaacttctctgtgggtagcaggcagacc
acggctcccgcctcggtcactgcggctgcggctgcagtagccgcggctgcaggcaccaca
gcagggctggtggaacaagccaagactttgttgaacaaaaaagcagacgtaaagccccag
acaaacagcaccaaaaacagcatagtcaccagtcccaagggaaacctcccctctcctgca
ctggagtcgtcggacagcagtaatgccacagtggaggatgaggaaatgaaagcacgcaaa
caggagatcatcaaaatcactgaacagcttattgaggccatcaacaatggcgactttgaa
gcctatgctaaaatctgcgaccctggactcacctgctttgaacctgaggccttgggaaac
ctggtggaggggatggacttccacagattttactttgagaacctgctctccaagaacagt
aagcccatccacaccaccatcctcaaccctcacgtgcacctgattggagaagaggccgcc
tgcattgcctacatccgcctcacacagtatgtggatggccagggccgaccgcgcagcagc
caatcagaggagacgagggtgtggcatcgccgggactccaaatggcagaatgtccatttc
cactgttcgggagctcctgctgcccctctgcagtga

KEGG   Danio rerio (zebrafish): 791855
Entry
791855            CDS       T01004                                 

Gene name
camk2g1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma 1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04114  Oocyte meiosis
dre04217  Necroptosis
dre04261  Adrenergic signaling in cardiomyocytes
dre04310  Wnt signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    791855 (camk2g1)
   04310 Wnt signaling pathway
    791855 (camk2g1)
   04020 Calcium signaling pathway
    791855 (camk2g1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    791855 (camk2g1)
   04217 Necroptosis
    791855 (camk2g1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    791855 (camk2g1)
   04916 Melanogenesis
    791855 (camk2g1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    791855 (camk2g1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    791855 (camk2g1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     791855 (camk2g1)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   791855 (camk2g1)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2
Other DBs
NCBI-GeneID: 791855
NCBI-ProteinID: NP_001025296
ZFIN: ZDB-GENE-050913-146
Ensembl: ENSDARG00000071395
Vega: OTTDARG00000021840
UniProt: Q4V9P8
LinkDB
Position
12
AA seq 560 aa
MATIVTSTRFTDEYQLYEELGKGAFSVVRRCVKKSTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCISQI
LESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAEQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSACKSLLNKKADGVKHQTNNTKNSVVSAVVNAMKESNTASSTPMEP
QTTVVHNPVDGPKGSTESCNTNEEEDMKGRKAESAQGASSDSAVMSQCSAGEEPPALVAS
PQGSPSTRKQEIIKITEQLIEAVNNGDFEAYTRICDPGLTSFEPEALGNLVEGMDFHKFY
FEHLLSKNNKPVHTTILNPHVHLIGEDAACIAYIRLTQYIDGQGRPRSCQSEETRVWHRR
DSKWLNVHFHCSGAPAAPLQ
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggctacaattgtaacctcgaccaggtttacggacgagtatcagctttacgaagagctc
ggaaagggtgccttctccgtggtgcggagatgtgtgaaaaaatccactggccaggaatat
gctgctaaaattattaacacaaaaaaattgtcagcaagagatcatcagaaactggaacgt
gaggcccgaatctgtcgtctactcaaacaccccaatattgttcggctccatgacagtatc
tcagaagaaggtttccattacctggtgtttgaccttgtgactgggggggagttgtttgag
gacatcgtcgccagagagtattacagtgaagctgacgcaagccattgcatcagtcagatc
ctggagagtgtcaatcatattcaccagcatgacatcgtgcacagagaccttaagcctgag
aacttgctgttggccagtaagatgaaaggagctgcagtgaaactggctgatttcgggctt
gccatcgaggtgcagggagatcagcaggcctggtttggttttgctgggacacctggttat
ctgtctccagaggtgttgaggaaggatccctacggcaaacctgtggacatctgggcctgt
ggtgtaatcttgtacattctgctagtgggctaccctccattttgggatgaagatcagcac
aagttataccagcagatcaaggccggagcttatgattttccttctccggagtgggacacg
gtcacccccgaggctaagaatctcatcaaccaaatgctgaccatcaacccagccaagaga
atcaccgcagagcaggccctcaagcacccatgggtctgccaacggtccacagtggcgtcc
atgatgcaccgccaagagaccgtggagtgcttgcgcaagttcaacgcccgcagaaaactc
aagggagccattctcactactatgctggtttctagaaacttctcagcttgcaaaagttta
ctcaacaaaaaggcagatggagtcaagcaccagacaaacaacactaaaaacagtgtagtg
agcgctgtagtgaacgccatgaaagaaagcaacacggcctcttctacaccgatggagcca
caaactacagttgtgcacaaccccgtcgatgggccaaagggctccacggagagctgcaac
accaatgaagaagaggatatgaaaggtaggaaagctgaaagtgcgcagggagcgagcagt
gacagtgccgtgatgagtcagtgcagtgccggggaagagccgcccgctctggtggcttca
ccacagggctctccttccactcgtaagcaggagattatcaagatcacagagcagttgatc
gaggccgtcaacaatggagactttgaggcatatacaagaatctgtgaccctggtctgacc
tcttttgagcctgaagctctgggcaacctggtggagggaatggacttccacaagttttac
tttgagcacttgttgagtaagaacaacaagcctgtgcacaccactatcctcaatcctcat
gttcatctgattggagaggacgctgcgtgcattgcgtatatccggctcacgcagtacatt
gatggccagggtcgcccgcggagctgccagtccgaggagacgcgtgtgtggcaccgccga
gatagcaagtggctcaacgtccacttccactgctcaggggcaccagctgccccattacag
tga

KEGG   Danio rerio (zebrafish): 793359
Entry
793359            CDS       T01004                                 

Gene name
camk2g2
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X26
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04114  Oocyte meiosis
dre04217  Necroptosis
dre04261  Adrenergic signaling in cardiomyocytes
dre04310  Wnt signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    793359 (camk2g2)
   04310 Wnt signaling pathway
    793359 (camk2g2)
   04020 Calcium signaling pathway
    793359 (camk2g2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    793359 (camk2g2)
   04217 Necroptosis
    793359 (camk2g2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    793359 (camk2g2)
   04916 Melanogenesis
    793359 (camk2g2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    793359 (camk2g2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    793359 (camk2g2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     793359 (camk2g2)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   793359 (camk2g2)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Pkinase_fungal Kdo RIO1
Other DBs
NCBI-GeneID: 793359
NCBI-ProteinID: XP_001332339
ZFIN: ZDB-GENE-070323-2
Ensembl: ENSDARG00000056206
Vega: OTTDARG00000029639
LinkDB
Position
13
AA seq 519 aa
MATIVTCTRFTDEYQLYEELGKGAFSVVRRCVKKSTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSIAEEGFHYLVFDLVTGGELFEDIVAREYYSESDASHCINQI
LESVSHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSACKSLLNKKSDGVKPQTNNNKNSVVSSSTKDSSISSTAPMEPQTT
VVHNPADGTKGSTESCNTTEEEDMKARKQEIIKITEQLIEAINNGDFEAYTRICDPGLTS
FEPEALGNLVEGMDFHKFYFENLLSKNSKPVHTTILNPHVHLIGEDAACIAYIRLTQYID
GQGRPRSSQSEETRVWHRRDAKWLNIHFHCSGAPAAPLQ
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggctacaattgtaacctgcaccaggttcacagacgaatatcagctgtacgaagagctc
ggaaagggtgccttctctgttgttcggcgatgtgtaaagaaatcaaccggccaggaatat
gctgctaagatcatcaacacaaaaaagttgtcggcaagagatcatcagaagctggaaaga
gaggcccggatctgccgtttgcttaaacaccccaacatagtgcgtctccatgacagtatc
gcagaagaaggctttcattacctggtgtttgacctggtgactggcggagaactgtttgaa
gacattgttgcaagagaatattacagtgaatcagatgccagtcattgcatcaatcagatc
ctggaaagcgtcagccacatccaccagcatgacattgtgcacagggacctcaagccagag
aacctgctgttggccagtaagatgaaaggggcggcagtgaagctggctgattttggcctt
gccatcgaggtgcagggagatcagcaggcctggtttggttttgctggcacccctggatac
ctctctccagaagtcttgagaaaggacccttatggcaagccagttgatatctgggcctgt
ggtgtgatcctgtatattctgctggtgggttatcctcctttctgggatgaggaccagcac
aaactgtatcaacagatcaaagctggagcctatgattttccctctccagagtgggacact
gttactccagaggccaaaaacctcatcaaccagatgctgaccatcaacccagcaaagagg
atcacggctgaccaggcactcaagcatccttgggtctgccaacgctccaccgtcgcctcc
atgatgcatcgtcaagaaaccgttgagtgtctgcgcaagttcaacgcccgcagaaaactg
aagggagccattttgaccactatgctggtgtccaggaacttctcagcatgcaaaagctta
ctgaacaaaaagtctgatggcgtgaagccacagacaaacaacaacaaaaacagtgtagta
agcagcagcaccaaagacagcagcatatcatccactgcaccaatggaaccacagaccaca
gtcgtgcacaatccagccgatggcaccaagggatctacagagagctgtaacaccacagaa
gaggaggacatgaaagcacgaaagcaggagatcattaaaatcacagagcagctgattgag
gccatcaacaatggagattttgaagcttacacgaggatctgtgaccctggcctgacctcg
tttgagccggaggcacttggaaacctggttgagggaatggatttccacaagttctacttc
gagaacttgctgagtaagaacagcaagcctgtgcacacaaccatactgaaccctcacgtg
cacctgattggagaggatgccgcctgcatcgcctatatccgcctgacgcagtacatcgac
ggccagggccggccacgcagcagccagtcagaggagacacgtgtgtggcaccgcagagat
gccaagtggctcaacatccacttccactgctctggagcgcctgccgcacctctacagtga

KEGG   Danio rerio (zebrafish): 798222
Entry
798222            CDS       T01004                                 

Gene name
camk2b
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X4
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04114  Oocyte meiosis
dre04217  Necroptosis
dre04261  Adrenergic signaling in cardiomyocytes
dre04310  Wnt signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    798222 (camk2b)
   04310 Wnt signaling pathway
    798222 (camk2b)
   04020 Calcium signaling pathway
    798222 (camk2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    798222 (camk2b)
   04217 Necroptosis
    798222 (camk2b)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    798222 (camk2b)
   04916 Melanogenesis
    798222 (camk2b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    798222 (camk2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    798222 (camk2b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     798222 (camk2b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   798222 (camk2b)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 798222
NCBI-ProteinID: XP_001338677
LinkDB
Position
10
AA seq 517 aa
MATTTCTRFTDEYQLYEELGKGAFSVVRRCAKLSTGQEYASKIINTKKLSARDHQKLERE
ARICRLLKHSNIVRLHDSISEEGFHYLLFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKCKNAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL
SPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTV
TPEAKNLINQMLTINPVKRITAQEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLK
GAILTTMLVSRNFSAAKSLLNKKTEVKPQSQSNSVKSSSVSSPKGSVPPPALEPQTTVIH
NPVDGIKESSDSSNTTIEDEDVRARKQEIIKITEQLIEGLNNGDFEAYAKMCDPGLTSFE
PEALGNLVEGMDFHRFYFENSLSKNSKPIHTTILNPHVHLIGEDGACIAYIRLTQFVDGQ
GLPRSSQSEETRVWHRRESRWQNIHFHCSGAPAAPLQ
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggcaaccacaacctgcacgcgcttcaccgacgagtaccagctctacgaggagctcgga
aaaggggctttctccgtggtgcgccgatgtgcgaaactcagcacgggtcaggaatacgcc
tccaaaatcatcaacaccaagaagctctcagctcgagaccaccagaagctggagcgtgag
gcgcggatctgccgtctgctaaaacactccaacatcgtgcgcctccatgacagtatatca
gaggagggcttccactacctgctgtttgacctcgtcacaggtggagagctgtttgaagac
atcgtggccagagaatattacagtgaagcggacgccagtcattgcatccagcagatcctg
gaggcggtgcttcactgccatcagatgggcgtggtccaccgagacctcaagccggagaac
ctgctcttggccagtaaatgcaagaatgccgccgtcaagttggcagattttggtctggcc
atcgaagtacagggagaccagcaggcctggttcggatttgctggaacgccgggttatctt
tctccagaggtgctccggaaagaagcgtatgggaagccggtggacatttgggcgtgtgga
gtcatcctctacatcctgctggtgggctatcctccattctgggatgaagaccagcacaaa
ctctaccagcagatcaaggctggagcgtatgactttccctccccggagtgggacacggtc
acccctgaagccaaaaacctcatcaatcagatgctgaccatcaacccggtcaagagaatc
acagcgcaggaggctctcaaacacccgtgggtctgccaacgctccaccgtggcgtcgatg
atgcacagacaggagacagtcgagtgcctgaagaagtttaacgccagacggaaactcaag
ggagccatactgaccaccatgctggtgtcgcgcaacttctccgcagccaagagtctgctc
aacaagaagactgaagtcaagcctcagtctcagtcaaacagtgtgaagagcagcagcgtc
tccagtcctaaaggaagtgttcctcctcctgctctggagcctcagaccactgttattcat
aatccagtggatgggataaaggaatcttccgacagcagcaacacaaccatcgaggatgaa
gacgtcagagcacgcaagcaggagatcatcaagatcacggagcagctgatagaaggcctc
aataatggagactttgaggcctatgcgaaaatgtgtgacccagggctgacgtctttcgaa
cccgaggctctggggaacctggtggagggaatggacttccacagattttactttgagaac
tcgctttccaagaacagtaaaccgatccacaccaccatcctgaaccctcatgtgcacctg
attggtgaagatggcgcctgcatcgcctacatccgcctgacacagtttgtggatggccag
ggcctcccacgcagcagccaatcagaggagacgcgggtgtggcaccgccgggaatccaga
tggcagaacattcacttccactgctccggcgctccagcggctcctctgcagtga

DBGET integrated database retrieval system