KEGG   Danio rerio (zebrafish): 445184
Entry
445184            CDS       T01004                                 

Gene name
lpar2a
Definition
(RefSeq) lysophosphatidic acid receptor 2a
  KO
K04291  lysophosphatidic acid receptor 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    445184 (lpar2a)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    445184 (lpar2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    445184 (lpar2a)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    445184 (lpar2a)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 445184
NCBI-ProteinID: NP_001003578
ZFIN: ZDB-GENE-040801-97
Ensembl: ENSDARG00000042338
Vega: OTTDARG00000034960
UniProt: Q6DC27
LinkDB
Position
3
AA seq 356 aa
MVFNSCEAFDNPVSYFYNRTGKPISPNWRTHDFVVVGLGLPICVFIILANMLVIAAIIVN
RKFHFPIYYLLGNMAAADLFAGISYSYLVFHTGPWTINLTIKEWFVRGALINMSLTASVV
NLLAVAVERHQTIFTMQLHTTMTRWRVVMLIVTIWVVAVVMGLVPTMGWNCVCDQLGCST
VAPLYSRSFLVFWAILNLMAFFIMVAVYTHIFIYVRRRSQVMSPHTDQPSNNQTVISLMK
TMSMILGAFVICWTPGLVILLLDGLKCIECHVLKYEKYCLVLAECNSLVNPIIYSFRDED
MRTTYKRILCFPWRRMRPHEGPSGIRFEPVKTGAPPEKNSQNSSSPEAAPPQSPLS
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggtatttaacagctgtgaggcttttgacaatccagtgtcttacttctacaacaggact
ggcaagcctattagtccaaactggcgcactcatgactttgtggtggtcggtctggggctc
cccatttgtgttttcatcatcctggccaatatgttggtcatagcggctataattgtcaac
cgaaagttccacttcccaatttattaccttttaggaaacatggcggccgctgacctcttc
gctggcatctcgtattcgtatctagtgttccacacaggaccctggaccatcaatttgacc
attaaggagtggtttgtgcgtggggcattgattaacatgagcctcaccgcctcagtggtc
aacctgttggcagtggctgttgagcgccatcagaccatcttcaccatgcagctccacacc
acgatgacccgctggcgggtggtcatgctgatagtcaccatctgggtggtggcagttgtc
atgggtttggtgcccaccatgggctggaattgtgtgtgtgaccagttaggttgcagcacg
gttgcgccactgtactcgcgcagcttcctagtgttttgggccatcctcaaccttatggcc
ttcttcatcatggtggccgtttacacgcacatcttcatctacgtccgccggcggagtcaa
gttatgtcccctcacacagatcagccctcaaataatcagacggttatcagccttatgaag
accatgtccatgatactgggtgcctttgtgatctgctggactccaggtctggtgatcctc
cttctggacggtctgaagtgcatcgaatgtcacgtcctgaagtatgagaagtactgcctg
gttctggccgagtgcaactctctggtgaaccccatcatctactcttttcgggacgaggac
atgaggaccacctacaaacgcattctctgcttcccttggagaagaatgcggccgcacgag
gggccttctggcatccgcttcgagcctgtgaaaacaggggctccccctgagaaaaacagc
cagaactccagcagcccagaggccgctcctccacaaagcccattgtcttga

DBGET integrated database retrieval system