KEGG   Danio rerio (zebrafish): 445202Help
Entry
445202            CDS       T01004                                 

Gene name
dpm1
Definition
(RefSeq) dolichol-phosphate mannosyltransferase subunit 1
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00510  N-Glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    445202 (dpm1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    445202 (dpm1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     445202 (dpm1)
Glycosyltransferases [BR:dre01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   445202 (dpm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_21 Glyco_tranf_2_4 MapZ_C2
Motif
Other DBs
NCBI-GeneID: 445202
NCBI-ProteinID: NP_001003596
ZFIN: ZDB-GENE-040801-115
Ensembl: ENSDARG00000057011
Vega: OTTDARG00000021286
UniProt: Q6DEJ9
LinkDB All DBs
Position
23
AA seq 250 aa AA seqDB search
MASRRSNAKSRDKPDKYSVLLPTYNERENLPLIVWLLVKYFGESGYNYEIIVIDDGSPDG
TLQIAEQLQKIYGADKILLRPRAEKLGLGTAYIHGIKHATGNFVIIMDADLSHHPKFIPQ
FIEKQKEGGYDLVSGTRYRGDGGVYGWDLRRKLISRGANFVTQVLLRPGASDLTGSFRLY
KKEVLEKLVEQCVSKGYVFQMEMIVRARQLGYTIGEVPISFVDRVYGESKLGGNEIVSFL
KGLLTLFATT
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccggagaagtaatgcgaagagtcgggacaaacctgacaaatattctgtcctt
ctgccgacttacaatgagcgagaaaacctcccgttgatcgtctggttgctggtgaagtat
ttcggcgaaagtggctacaactatgagatcatagtcatcgatgatggcagtccagacgga
acactgcagatcgccgagcagctgcagaagatttacggcgcggataaaattctcctgaga
ccgcgagcagaaaagctgggattaggtacggcctacatccacggcattaaacatgcaaca
ggaaacttcgttatcataatggatgcagatctgtcacatcatccaaagtttatcccacag
ttcattgaaaaacagaaagaaggtggatatgacctggtgtctggcacaaggtacagagga
gatggtggtgtgtatggatgggatctgcggcgaaaacttatcagtcgaggggcaaacttt
gtaacacaagttctgctcagaccaggagcgtctgatcttactgggagttttaggctctat
aagaaagaggttctggaaaaactagtggagcagtgtgtgtcaaaaggctatgtgttccag
atggagatgattgtccgggccagacaactgggctatacaattggagaggttcccatttca
tttgtggaccgtgtttatggagagtccaaattaggtggaaatgaaatcgtctccttcctg
aaaggactgctcactctttttgccactacatga

DBGET integrated database retrieval system