KEGG   Danio rerio (zebrafish): 445234
Entry
445234            CDS       T01004                                 

Gene name
crk
Definition
(RefSeq) adapter molecule crk
  KO
K04438  C-crk adapter molecule crk
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    445234 (crk)
   04012 ErbB signaling pathway
    445234 (crk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    445234 (crk)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    445234 (crk)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    445234 (crk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    445234 (crk)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   445234 (crk)
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9 hSH3
Other DBs
NCBI-GeneID: 445234
NCBI-ProteinID: NP_001003628
ZFIN: ZDB-GENE-040801-148
Ensembl: ENSDARG00000055635
Vega: OTTDARG00000020757
UniProt: Q6DEM2
LinkDB
Position
15
AA seq 311 aa
MAGNFDSEDRGSWYWGRLSRQEAVSLLQGQRHGVFLVRDSITIPGDYVLSVSENSKVSHY
IINSISSNRQSGPGLAPPRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPISKSKHSSFI
SVNAGTGGAPPRLEEEYVRALFDFPGNDDEDLPFRKGDVLRVLEKPEEQWWNAQNSEGRV
GMIPVPYVEKYRPASPTSGAPGVSVSGSGAHGNSDGHSTQSPPLLGEPGQYAQPTSLPNL
QNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECKGKHGHFPFTHVRL
LDQHNPEDELS
NT seq 936 nt   +upstreamnt  +downstreamnt
atggccggaaattttgattcggaggaccgagggagctggtattgggggagattaagccgg
caagaggcggtttcgctgctccaagggcagaggcatggagtgttcctggtgcgggactcg
atcactattcccggggactacgtgctgtctgtgtcggagaactccaaagtctctcattac
ataataaacagcatcagcagcaatcgccagtcaggaccagggcttgctcctcctcggttc
cggattggagatcaggaatttgatgccttacctgccctgttggagttctacaaaatccac
tacctggacaccaccactctcattgagcccattagcaaatcaaagcactcgtctttcatc
agcgtcaatgcggggacaggaggagctcctccgaggctagaagaggagtacgtcagagct
ctcttcgactttcccggcaacgacgacgaggaccttccatttcgaaagggtgatgttctt
cgagtgctggagaagccagaggagcaatggtggaatgctcagaattcagaaggccgtgtt
ggcatgatccctgtgccctatgtggagaagtaccgacctgcctcaccgacatcaggtgca
cctggcgtatcagtcagtgggtccggtgctcacggcaactctgacggccacagcactcag
tctccacctctgcttggtgaaccgggccaatacgcccagcccacatccttacccaatcta
cagaatggcccagtttatgccagggcgattcagaagagagtccccaatgcctatgataag
acagctcttgctttggaggtcggcgacatggtaaaggtgaccaagatcaatgtaaacggg
cagtgggagggtgagtgcaagggaaagcatggccattttccctttacccacgtccgcttg
ctggaccagcacaatccagaggacgaactaagctga

KEGG   Danio rerio (zebrafish): 556443
Entry
556443            CDS       T01004                                 

Gene name
crkl
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    556443 (crkl)
   04012 ErbB signaling pathway
    556443 (crkl)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    556443 (crkl)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    556443 (crkl)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    556443 (crkl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    556443 (crkl)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   556443 (crkl)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10
Other DBs
NCBI-GeneID: 556443
NCBI-ProteinID: NP_998703
ZFIN: ZDB-GENE-040426-2951
Ensembl: ENSDARG00000028699
Vega: OTTDARG00000031521
UniProt: Q6PH06
LinkDB
Position
21
AA seq 305 aa
MSSARFDSSDRASWYFGPVSRQEAQNRLQGQRHGMFLVRDSSTCPGDYVLSVSENSKVSH
YIINSLPSKRFKIGDQEFDNLPGLLEFYKIHYLDTTTLIEPAPRYPSTALPSGPIQPSGG
LGDENQEYVRTLYDFTGSDAEDLPFKKGEILIIMDKPEEQWWSAKNKEGRTGMIPVPYVE
KLVRSSPHPGQSIHGSRNSNSYGIPEPSHAYAQPQTPSPIPPGTPGAVINPLPSVQNGPV
LAKAIQKRVPCAYDKTALALEVGDIVKVTRMNISGQWEGEVNNRRGLFPFTHVKILDPQN
PDESE
NT seq 918 nt   +upstreamnt  +downstreamnt
atgtcgtctgcacggttcgactcctcagaccgagccagctggtatttcgggccggtttcg
agacaggaggcgcagaataggctacagggacagagacacgggatgtttttggtgcgagat
tcgtccacttgtcctggtgattatgtactttcagtgtccgaaaactccaaagtttcgcac
tatatcatcaactctttgccaagcaagagattcaagataggcgatcaagagtttgataat
ctacccggccttttggagttctataaaatacattatttggatacgaccaccctcatagaa
ccagcaccaaggtaccccagtactgctctgcccagtggtcctattcagccatctggagga
ctgggtgatgagaaccaggagtatgtgcggactctttatgacttcactggcagcgatgct
gaagaccttcctttcaagaagggtgaaatcctaataattatggacaagcctgaggagcag
tggtggagtgccaagaacaaagaaggccgaacaggcatgattcctgttccctatgtagaa
aagcttgtgagatcttcgcctcatcctggtcagtccatccatggttcacggaattccaat
agctatggcatccctgagccatcacacgcctatgcccagcctcagactccatctcccatt
cctcctggtacacccggcgctgtcatcaacccgctaccttctgtgcagaatgggccagtg
ttggcgaaggcgatccagaaacgagtgccatgcgcatatgacaaaactgctttagcactg
gaggtgggtgacattgtgaaggtgactaggatgaacatcagtggtcagtgggaaggggag
gtaaacaaccggagaggtttattccctttcactcatgtgaaaatactggacccccaaaac
ccagacgagagtgaatga

DBGET integrated database retrieval system