KEGG   Danio rerio (zebrafish): 447811
Entry
447811            CDS       T01004                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 447811
NCBI-ProteinID: NP_001004550
ZFIN: ZDB-GENE-040912-14
Ensembl: ENSDARG00000004840
Vega: OTTDARG00000009385
UniProt: Q66HV2
LinkDB
Position
22
AA seq 363 aa
MAKCELIELQDLTPNDRIELAPPSVPPPTVVPTLDRWSRGKVVRMVGERVRLEDPDWLTC
KPGRGHDFQPCSQTQLSWCDLCGEFIWGLYRQSLRCTHCNYTCHYRCQPFIQLDCSSNTD
TICEQSNYSEDTIETDTNVDEQSEVDWRKQDLSVTEIQQKVKEYNAQVNSNLFMVLNRDG
SYTGFIKVQFKLARPVSLPPPRSVSSSSISSSCLGWDGGCQERTSFYLPRDTVKHLHISS
STRAREVIQALLNKFTVVDNPAKYSLYERSQRDNQVYLRKLADDECPLFLRLCAGPNEKV
LSLVLKENETGEVNWDAFSFPELQNFLRILQREEEDHVRQIIRRYTLARDKMKEAMKNFS
KPG
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcaaaatgtgagctcatcgagttgcaggacttgactccgaatgaccgtattgagctg
gcaccccctagtgtccctccacccaccgtggtgcccactctggacaggtggagcagaggg
aaggtggtgcgcatggtgggcgagcgcgtgcgcctggaggaccccgattggctgacgtgt
aaaccaggacgaggacatgactttcagccctgcagccagacacagctgagctggtgtgac
ctgtgtggagagttcatctggggcctgtacagacagagcctccgctgcacacactgtaac
tacacttgtcactaccgctgtcaacccttcattcagctggactgcagctccaacaccgac
actatctgcgaacaatcaaactacagcgaggacaccatcgagacagacaccaatgtggat
gagcagtctgaagtggactggaggaaacaggatctgtctgtcactgaaatacagcagaaa
gtgaaggaatacaatgctcaggtcaacagtaacctcttcatggttctgaatcgtgacggc
tcatacactggcttcatcaaggtccagtttaagctggcgcgacccgtgtctcttcctcct
ccccgcagcgtctcctcctcctccatctcctcctcttgtttaggatgggatggcggctgt
caggagcgaacttccttctacctgcccagagacacagtcaagcacctgcacatcagctcc
agcacccgtgccagagaggtcatccaggccctgctcaacaagttcactgtggtggacaat
ccggctaaatattccctgtatgagcgcagccagcgggacaatcaagtgtacttaaggaag
ttagctgatgatgaatgtccacttttcctgcgtctgtgtgctggacccaatgagaaagtc
ctgagtttagtgcttaaagagaatgaaaccggggaagtgaattgggatgcgttcagtttt
cctgaactccagaacttcctgcggattctccagcgggaggaagaagatcacgtccggcaa
atcatacgccgatacactctggctcgtgataagatgaaagaggctatgaagaacttcagc
aagcctggctga

DBGET integrated database retrieval system