KEGG   Danio rerio (zebrafish): 449537Help
Entry
449537            CDS       T01004                                 

Gene name
hsd17b2
Definition
(RefSeq) estradiol 17-beta-dehydrogenase 2
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00140  Steroid hormone biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    449537 (hsd17b2)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     449537 (hsd17b2)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     449537 (hsd17b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776
Motif
Other DBs
NCBI-GeneID: 449537
NCBI-ProteinID: NP_001035278
ZFIN: ZDB-GENE-040928-1
Ensembl: ENSDARG00000045553
Vega: OTTDARG00000028435
UniProt: Q1PLL0
LinkDB All DBs
Position
25
AA seq 358 aa AA seqDB search
MYTSGIVLYVSFIRSNKRPIAFTSKWRSRGAVAVELSIERRPLVILSSLTTLYFRKIFTL
AGVFSCDSGFGHELAQVLDRAGMRVFAGVLDELSPGALKLKESASVNLTVLQLDITNNTQ
ITQTHQFIKSQTGKTGLWALVNNAGVLGYVCDGEILPMKMYKSCLDVNFLGSVMMTHTFL
PLIRQSRGRVINITSMAGEVPLVGFAGYGASKAALNIYSGAIRQELSRWGVRVIIVQPGA
FRTNILGSSEQWERAQEQILSGLSEEVKDSYGEEYIHSMQKRLLDMSSASSEDKGPFLQS
LKHAILSSNPKHFYYPGAGAWVLSLLYRYCPTALSDKIFSGMFMSGVQPAELARAIPH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtacacctctggcattgttttgtatgtgtcgttcataagatccaataaacggccgatc
gctttcacttcaaaatggcggagtcgcggggctgttgctgtggaactttctattgagcgt
cgccccttggtgattttaagctctttgaccacactgtactttcggaaaatcttcaccctg
gccggagttttcagttgtgactcagggtttggtcatgaactggcccaggttttggaccgt
gcggggatgcgtgtgtttgcaggagttctggatgaactcagtcctggagctctgaaactg
aaggagtctgcatctgtaaacctcaccgtcctgcagttagacatcaccaacaacacacag
atcacacaaacgcatcagttcatcaagagccaaactggcaaaacaggactctgggctctg
gtgaacaatgcgggagtgctgggatacgtgtgcgatggggaaattctgccaatgaaaatg
tataaatcgtgcttggatgtgaatttcctcggcagtgttatgatgacacacacatttctg
cctctgatacgacaatccagaggaagagtcatcaacatcaccagtatggcaggagaggtc
cctcttgtggggtttgcaggttatggcgcatcaaaagcagcgttgaatatttacagcgga
gcgatcagacaagagctgtcccgctggggtgtcagagtcatcatcgttcagcccggagct
ttcagaaccaatatcctgggcagcagcgagcagtgggagcgcgctcaggagcagatcctc
agtggtttatcagaagaggtgaaggactcttatggtgaagaatacattcactccatgcag
aagcggctgctggatatgtcttcagcatcaagtgaagacaaggggccgtttctgcagtct
ttaaagcacgcgatactgtcctccaacccaaaacacttctactaccccggggccggagcg
tgggtgctgtctttactgtacagatactgtccgacggcactgtccgataaaatcttctcc
gggatgtttatgagcggcgtccagcctgcagaactcgccagagcgattccacattaa

DBGET integrated database retrieval system