KEGG   Danio rerio (zebrafish): 449662Help
Entry
449662            CDS       T01004                                 

Gene name
acox1
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00071  Fatty acid degradation
dre00410  beta-Alanine metabolism
dre00592  alpha-Linolenic acid metabolism
dre00640  Propanoate metabolism
dre01040  Biosynthesis of unsaturated fatty acids
dre01100  Metabolic pathways
dre01200  Carbon metabolism
dre01212  Fatty acid metabolism
dre03320  PPAR signaling pathway
dre04146  Peroxisome
Module
dre_M00087  beta-Oxidation
dre_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    449662 (acox1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    449662 (acox1)
   00592 alpha-Linolenic acid metabolism
    449662 (acox1)
   01040 Biosynthesis of unsaturated fatty acids
    449662 (acox1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    449662 (acox1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    449662 (acox1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    449662 (acox1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     449662 (acox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1 Peptidase_C39 DELLA
Motif
Other DBs
NCBI-GeneID: 449662
NCBI-ProteinID: NP_001005933
ZFIN: ZDB-GENE-041010-219
Ensembl: ENSDARG00000014727
Vega: OTTDARG00000027241
UniProt: Q5XIZ4
LinkDB All DBs
Position
6
AA seq 660 aa AA seqDB search
MNPDISRERENASFNLEILTNVLDGGAEKTNRRREIESLVIGDPDFQHEDLNFLSRSERY
DAAVRKSAQMILKLREYGISDPEEIYSYKTVVRGVFQEPLGVHNVMFIPTLKSQCTAEQR
KKWIPLAESFHMLGTYAQTELGHGTHIRALETTATYDPSTQEFVLNSSTISSIKWWPGGL
GKTSNHAIVLAQLYTQGKCHGLHAFITPIRCMKTHMPLPGVVVGDIGPKFGFDEVDNGYL
KLENVRIPRENMLMKYAQVEPDGTYVKPPSDKLTYGTMVFIRSMIVGESARALSKSCTIA
IRYSAVRHQSELRPGEPEPQILDYQTQQYKLFPLLATAYAFHFVGQYMNKTYHRISGDIS
LGDFSELPELHALSAGLKAFTTWAANTGIEVCRMSCGGHGYSRCSSLPDIYVTFTPTCTY
EGENTVMMLQTARYLVKSYKQARAGQQLTGIVSYLNESQSRIQPHSVSSRPTVVNINDLV
SLVEAYKFRAAKLVEVAAKNLQLELQHSKSNEDAWNNTSIDLVRASDAHCHYVVVKLFAA
KLSEIGDKAVHSVLSTLALLYALHGVAQNSGDFLKAGLLSVSQLDQISQRLKGLLLEIRP
NAVALVDAFDYRDEMLNSSLGRYDGNVYEHMFEWAKKSPLNHTEVHESHNKYLKPLRSKL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctgatattagccgtgaacgtgaaaatgcgtcttttaacctggagattcttaca
aacgtgctggatggtggagcggaaaagacaaatagaaggagagaaatagagtctctggtt
attggagatccagatttccaacatgaagacctaaactttctctctcgaagtgagcgatat
gatgcagcagtgcggaagagtgcacagatgattctgaaacttagggaatatggtatctct
gatccagaagagatctactcctacaagactgttgtgaggggtgtatttcaagagccccta
ggtgtccataatgtcatgttcatacccaccttaaaaagccagtgtactgctgaacaacgc
aaaaaatggatcccattagctgagtcattccatatgttaggcacctatgctcagacagag
ctggggcacggtacacacatccgtgctcttgaaaccactgccacatatgacccttccacc
caagagttcgttttgaacagttcaacaatctcctcaattaaatggtggccaggtggattg
ggtaaaacctcaaaccatgctatagtcctggctcagctgtacacgcagggcaagtgtcat
ggcctgcatgctttcatcacacccattcgctgtatgaagacacacatgccacttccaggt
gtggtcgttggtgatattgggcccaaatttggttttgatgaggtggataatggctatttg
aaactggaaaatgttagaattccacgagagaatatgcttatgaagtatgcccaggttgaa
ccggatggtacatatgtgaagcctcctagtgataaactcacatatggtaccatggtgttt
attcgctccatgatagtgggagagtcagcacgagctctctccaaatcctgcactattgcc
attcgctacagtgcagtccgacatcagtctgaactacgcccaggtgaacctgagccacag
atcttggactatcaaacccagcagtataaactatttcctcttctggctactgcatatgcc
tttcactttgtagggcagtacatgaataaaacataccatcgcatctcaggagacatcagt
ctgggtgacttcagtgagcttccagagctgcatgccttgtcagctggtctgaaagctttt
accacctgggcagcaaatactggcattgaggtatgtcgtatgtcatgtggtggtcatggc
tactcccgctgcagcagtttacctgacatctacgtcacttttacgccaacctgcacttat
gagggagagaatacggttatgatgctgcagacagctaggtatttggtgaagagctacaag
caagcacgggcaggacaacagttgactggcattgtgtcttacctgaacgaatctcagagc
aggatacagccccattctgtgtcttcccggcctactgttgtcaatattaatgacctggtc
agccttgtcgaggcatacaagttcagagctgcaaagttagttgaagttgcagctaagaac
cttcagttggagctacagcacagcaagagtaacgaagatgcctggaacaacacttccatt
gatctagtcagagcatctgatgcccattgccattatgtggttgtgaagctatttgctgct
aaactgagtgagattggagataaggctgtccactcagtactcagcactttggctctgctt
tatgcccttcatggagttgcacagaattctggggactttttaaaggctggtctgctaagt
gtttctcagctggatcagatttcacagaggctgaagggtctcctcttagagataaggccc
aatgcagtggctctcgttgatgcttttgactaccgtgatgagatgcttaattcttctctg
ggacgatatgatggcaacgtctatgagcacatgtttgagtgggccaagaagtcacctctg
aaccatactgaggtccatgagtcccacaacaagtatttgaagccactacgatccaaattg
taa

DBGET integrated database retrieval system