KEGG   Danio rerio (zebrafish): 449784Help
Entry
449784            CDS       T01004                                 

Gene name
mgst1.1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00480  Glutathione metabolism
dre00980  Metabolism of xenobiotics by cytochrome P450
dre00982  Drug metabolism - cytochrome P450
dre00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    449784 (mgst1.1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    449784 (mgst1.1)
   00982 Drug metabolism - cytochrome P450
    449784 (mgst1.1)
   00983 Drug metabolism - other enzymes
    449784 (mgst1.1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    449784 (mgst1.1)
Enzymes [BR:dre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     449784 (mgst1.1)
Transporters [BR:dre02000]
 Other Transporters
  Pores ion channels [TC:1]
   449784 (mgst1.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 449784
NCBI-ProteinID: NP_001005957
ZFIN: ZDB-GENE-041010-30
Ensembl: ENSDARG00000032618
Vega: OTTDARG00000023068
UniProt: Q5XJJ0
LinkDB All DBs
Position
4
AA seq 154 aa AA seqDB search
MAEVVHMIDSEVFLAFSTYATIVILKMMLMSLMTSYLRLTKQVFSNLEDTAMAIAEDKKK
LVRTDPDVERVRRCHLNDLESIVPFVVIGLLYALTGPVLSTALLHFRVFVVSRFIHTVAY
IMALPQPTRGVAFGVGLLTTLSMAYRVLTTALFL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttgtgcacatgatcgacagtgaggtctttctggccttctccacatacgca
accatagtcatcctcaaaatgatgctcatgagcctcatgacctcttacctgcgattgaca
aaacaggtcttctccaacttggaggacaccgccatggcaatagcagaagacaagaaaaaa
ctggttaggactgatccagatgtggaaagagtgcgacgatgccatctgaatgacctggaa
agcatcgttcctttcgtggtgatcggtcttctgtatgcactgacggggccggttctctcc
actgctcttttgcacttccgggtgtttgtagtgtcccgattcatccatacagtcgcgtac
ataatggctcttccgcaacctaccagaggtgtagcctttggcgtagggctgcttacaact
ttatctatggcctacagggtgctcactactgctctttttctttaa

DBGET integrated database retrieval system