KEGG   Danio rerio (zebrafish): 492364
Entry
492364            CDS       T01004                                 

Gene name
cbl
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04120  Ubiquitin mediated proteolysis
dre04144  Endocytosis
dre04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    492364 (cbl)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    492364 (cbl)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    492364 (cbl)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    492364 (cbl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    492364 (cbl)
   04121 Ubiquitin system [BR:dre04121]
    492364 (cbl)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     492364 (cbl)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    492364 (cbl)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    492364 (cbl)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 UBA zf-RING_UBOX zf-RING_5 zf-rbx1 zf-RING_4 zf-C3HC4_4
Other DBs
NCBI-GeneID: 492364
NCBI-ProteinID: NP_001007331
ZFIN: ZDB-GENE-041114-207
Ensembl: ENSDARG00000009958
Vega: OTTDARG00000022950
UniProt: Q5U376
LinkDB
Position
15
AA seq 913 aa
MAGNLKKGGGLIGMMKDAFQPHHHLHHSHHQPGAVDKKTVEKCWKFMDKVVRLCQNPKLA
LKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGDNEYFRVFMENLTKKTKQTISLFKDG
KERMFEENSQPRRNLTKLSLIFSHMLAELKAIFPNGLFQGDNFRITKADAAEFWRRSFGD
KTIVPWKVFRQALHEFHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLR
NWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQ
TIPHNKPLFQAHIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGS
TFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGCPFCRCEIKGTEPIVVDPFDP
KDPNSAASYGCRGMFGAEGAPSPSYDDDDDDRLEETPFMISKLVGSKVERPPSPMSISPQ
PVVPPVPPRLDLLPLRPTNPPGASSPGATSKAPSHHKDKPLPLPPALRDLPPPPPPDRPH
PAGADNRLPRRPLPSTPGDPSRDKLPPAPPNRNMPDWNSRPVPKAPSQPPASGDTRGSRE
LSNRHSLPLQLPSTLDSRTEAPRNNGPPSLDHQLSFGSSNPASDYDSPKVKPSASANAIY
SLAIRPVAAARTQTGEETNENDEESEYMTPSSRPVLPSAAGEAVPRPPPPLSLSPRSMLN
ELESESPQMYEAMYNIQAQALTASAPQARDSDYSELPPLTCSNGPRDPVGAYAEEEEEEE
NSYDYPKPHLSAALARRTLSDANSPSSSAFSRLSFDSDLGAAATVLDPSEAPERPPKPLP
RRINSDRRPSPVPPGASPGPSQQISSEIEHLLSQGYSHQDIQKALMIAQNNIEMAKNVLR
EFVSIPSTAHILT
NT seq 2742 nt   +upstreamnt  +downstreamnt
atggcaggaaatctgaagaaaggtggggggcttattggcatgatgaaggacgcttttcag
cctcaccatcacctccaccactcccatcaccagcccggagccgtggacaaaaagacggtg
gagaaatgctggaaattcatggataaggtggtacggttatgccagaaccccaaattggcc
ttgaagaacagtcctccgtacatcctagacttgctgccagatacataccagcatctccgc
actatcctgtctcgatatgaaggcaagatggaaacgctaggcgacaacgagtacttccgt
gtttttatggagaacttgaccaagaagaccaaacagaccataagcctgttcaaagatggc
aaagagcgaatgttcgaggagaactctcagcccagacggaacttaacaaagttgtcgctg
attttcagtcacatgctcgctgagctcaaagccatctttcctaatggtctgtttcaaggg
gacaacttcagaatcaccaaagcggatgccgcagagttctggagaagatcgttcggggac
aagaccattgtgccttggaaggtgttccgtcaggccctgcatgagtttcaccccatcagc
tcaggcctggaggccatggcactgaaatccaccatcgacctcacatgcaacgactacatc
tccgtttttgagtttgacatcttcaccaggctattccagccatggtcgtcattgttgaga
aactggaacagcctggcagtgactcatcccgggtacatggcttttctaacctatgatgaa
gtcaaagctcgtctacaaaaattcatccacaagcctggcagctatatcttcagactgagc
tgtacgaggctcggacagtgggctatcggttacgtcacggctgatggaaacatcttgcag
accattcctcataacaaacccctcttccaggcccacatcgatggctttagagaaggattc
tacctttttccagatggacgcactcaaaacccagacctcacaggactgtgtgaaccctca
cctcaagaccatatcaaagtcacacaggagcaatatgagctgtactgtgagatgggctct
accttccagctgtgtaagatttgtgctgagaatgacaaggatgtgaagatcgagccctgc
ggacacctcatgtgcacttcctgtcttacagcctggcaggagtcagaaggccaaggctgc
ccattctgtcgctgtgaaattaagggtacagagcccatcgtcgttgacccctttgatcct
aaggatcccaacagcgctgcctcctatggctgcaggggcatgtttggggctgagggagcc
ccttcacccagctacgacgatgatgatgatgaccgtttagaggaaactcctttcatgatt
agcaagctggtcggctctaaagtggagaggccgccctcgccgatgtcaatctcccctcag
cccgtcgttcctccagtacctcctcggctggatctgcttcctctcaggcccaccaaccct
cctggggcctcaagtccaggggccacatccaaggccccttcccatcacaaagacaagcca
ttaccgctgccgccggctctaagggatctgccacctccacctcccccagaccgtccacac
ccagctggagcagacaaccgtctcccaagacgtcctctccccagtacgcctggagaccca
tctcgtgacaaactgcccccggcccctcctaaccgcaacatgccagactggaactcccgg
cctgtacccaaagccccatcacagccaccagcaagcggagacacccgtggatctcgagag
ctttccaacaggcactctctgcctctccaactgccctctactctcgattccagaacagaa
gcccccagaaacaacggccctcccagcctcgaccaccagctgagttttggatcatcgaat
cctgcatcggattatgacagtccaaaagtaaagccgtctgcctcggctaatgccatctat
tccttggcaatacggcctgttgcagcagcaagaacacagacaggggaggaaaccaatgag
aatgacgaggagtccgagtacatgactccatcttctcgaccagtgctgccctctgctgca
ggggaggctgtgcccagaccacctccaccactctcactcagtcccagaagtatgctcaat
gaattagagtcagaaagtccacagatgtatgaagccatgtacaacatccaagcacaggcc
ctcacagcttctgcaccacaggccagagactcggattactccgaattgcctcctttgacc
tgctctaatggcccgcgggatcctgtcggtgcatatgctgaggaggaggaggaggaggag
aacagctatgactatcccaaacctcatctatctgcagctctagcccgacgcacgctttca
gatgctaactcaccatcctcctcagccttcagccgcctctcctttgacagtgaccttgga
gcagctgcaactgtcctggacccctctgaagcccccgagcggcctcctaagccattgccc
cgtcgcatcaactcggatcgcagacccagtccagttccccccggggcgagtccaggcccc
agccagcagatcagcagtgagatcgagcacctcttgagccagggatactcccatcaggac
atccaaaaagccctaatgattgcacagaacaatattgaaatggccaagaacgtcctgagg
gagtttgtgtccatcccttctactgcacatattttaacataa

KEGG   Danio rerio (zebrafish): 556277
Entry
556277            CDS       T01004                                 

Gene name
cblb
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-B isoform X1
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04120  Ubiquitin mediated proteolysis
dre04144  Endocytosis
dre04625  C-type lectin receptor signaling pathway
dre04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    556277 (cblb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    556277 (cblb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    556277 (cblb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    556277 (cblb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    556277 (cblb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    556277 (cblb)
   04121 Ubiquitin system [BR:dre04121]
    556277 (cblb)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     556277 (cblb)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    556277 (cblb)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    556277 (cblb)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 zf-RING_4
Other DBs
NCBI-GeneID: 556277
NCBI-ProteinID: XP_001921961
ZFIN: ZDB-GENE-030616-417
Ensembl: ENSDARG00000015199
Vega: OTTDARG00000008165
UniProt: F1Q742
LinkDB
Position
10
AA seq 939 aa
MATALSGRPPNNRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPRL
QLKNSPPYILDILPDTYQHLRLILCKYEENQRLTQLSENDYFKVYIDSLMKKSKRAIRLF
KEAKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPGGQFQGDTFRITKADAAEFWRRS
FGEKTIVPWKMFRQCLHDVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGS
ILRNWNFLAVTHPGYMAFLTYDEVKARLQKYINKPGSYIFRLSCTRLGQWAIGYVTSDGN
ILQTIPHNKPLFQALIDGCREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCE
MGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQDSDGQGCPFCRCEIKGTEPIIVDP
FDPRNEGAKCFHLDHFSSPLLDPDDDDDRDGLLVIDHIKKSMEIQNSPIMSPNSSPVCER
RKTAADHMGPHLNIPPVPPRLDLIRSPAPSPTASPKSSPGMSRKQDKPLPAPPPPQRDPP
PPPPPERPPHLPQEGRAAWLVTPSSGLPRDPRAPLEAWSPKDSTALSDCRTSAADRSPKL
AHAAPAHINERPLSCSSADLGLNRNRLIAQTECSKSFVNGLLPGDEYDIPPLRHSPPILD
NNQRHMNPFTSPRSLTDRVEDDYQIPSSHPVCITQPAICIPFRIPNRALENGSTDHSTDI
KKHKPPEHGGFDSGPLISAVSHTTQCPLHNRTPSDYDILLPPQASPMEDPFNALPPSQPP
PPPPIRNSFTEASSSSLYPRPARPSSGHDHFLLSPDTFIDSLNNSAPSPPVRRQTGDNMK
TPFRAPQDYDQLPPTSVAGDCFRAPERPPKPLPRIIPPDIHRRPHESSRENVDAKIAKLM
GEGYSFEDVKRALMIAQNKVDVARNILREFALVAPRQGL
NT seq 2820 nt   +upstreamnt  +downstreamnt
atggcaactgctctcagtggacgcccacctaacaatcggaaaggccgtattttaggcatt
attgacgccatccaggacgctgtcggacccccaaagcaagcggccgcggaccgccggacc
gtagagaagacatggaaactcatggacaaagtggtgaggttatgtcagaaccccagacta
cagctgaagaacagtcctccatacatcctggatattttacccgacacataccagcacctt
cgactgattttgtgcaaatacgaggagaaccagagactcacccagctgagcgagaatgac
tatttcaaagtgtacatcgacagcctgatgaagaaatccaaaagagcaattcgcctcttt
aaggaagccaaagagagaatgtacgaagagcagtcacaagacagacgaaacctcaccaaa
ctttccctgattttcagtcacatgttggccgaaataaaagctatttttcctggtggacag
ttccaaggagacacatttcgcatcaccaaggccgacgctgcagaattttggagaaggtca
tttggagaaaaaacaatagtgccatggaaaatgttccggcagtgccttcacgacgtgcac
cccatcagctcggggttggaggccatggctctgaaatccaccatcgacctcacctgcaat
gactacatctctgtttttgagtttgacatcttcactcgtctttttcagccatggggctcg
atcctgagaaactggaacttcctagcagtcacacatccaggctacatggccttcctgaca
tatgatgaagtgaaggcacgtctgcagaagtacatcaacaaacctggcagctacatcttt
agactgagttgcacgcggttaggccagtgggccattggctatgtcactagtgatggaaac
atcctgcagaccatcccacataataaaccactgttccaagcgctcatcgatggatgcaga
gaaggattttatctgtttccagacgggcgcagttataaccctgatctcacaggcctgtgt
gaacccactccgcacgaccacattaaggtcacgcaggagcagtatgagttgtactgtgag
atgggctctacgtttcaactttgcaagatatgtgctgaaaatgataaagatgtaaagata
gagccatgtggtcacctcatgtgcacttcctgtttgacatcatggcaggattctgatggt
cagggttgccctttctgccgctgtgagatcaaagggactgagcccatcattgtggatccg
tttgacccacgtaacgaaggggccaaatgcttccacctggaccacttcagctcccccttg
ctggacccggatgatgatgatgacagggatggattgctggtcatagaccatatcaagaag
tccatggagatccagaactcgccgataatgtctccgaactcgtctccagtgtgtgaacgc
cgaaaaactgctgcagatcacatgggtccacacttaaacattccacccgtcccaccccgt
ctcgacctcatccgctctcctgctcccagtcccacagcctcaccaaagtcatctccagga
atgtccagaaaacaggacaagccccttcctgcccctccacctccacagagagacccccct
ccacctcctccgccagaacggcctcctcatctccctcaagaaggtcgcgctgcatggctc
gtcaccccttcgtccggccttcctcgagaccctagagcacccctagaggcctggagccca
aaagacagcactgcattgtcagactgcagaacgtctgcagcagaccgttcccccaaactc
gcccacgctgcccctgcacacatcaacgagagacccctcagctgctccagcgcagacctg
gggttgaaccggaacagactgatcgcccagaccgagtgtagtaagtctttcgttaatggt
ctgttacctggtgatgagtatgacattccccctctgcgtcactcccctcctattctggac
aacaaccagagacacatgaaccccttcacaagccctcggagtctgacagacagagtagag
gacgactaccagattccctcatcgcatcccgtttgcatcacacagccggccatctgcatc
cccttccgcatccccaacagagctttagaaaatggctcgacagatcactccacagatata
aagaaacataaacctccagaacatggtgggtttgactccgggccgttgatttctgcagtg
tctcataccacacagtgtccccttcacaacagaacgccctcagactatgacattctactg
ccccctcaagcatctccaatggaagacccattcaacgctcttcctccatctcagcctcct
cctcctccaccaatcaggaatagtttcacggaagcctcgtcctcgtctttataccccagg
cctgcccgaccctcatcgggacacgaccactttttactcagccccgacactttcatagac
tcattgaataactcggctcccagtcctccagtacggagacaaacaggtgacaacatgaag
acgccgttcagggccccgcaagactacgatcagctgccgcccacatcagtggccggagat
tgtttcagggcgcctgagagacctccaaaaccacttcctcgaatcatcccgccagacatc
cacagaagaccgcacgaatcgtccagggagaacgtcgacgccaagattgccaagctgatg
ggggaaggatactcgttcgaggacgtcaaacgagcgctgatgatcgcgcaaaacaaggtg
gacgtggcacggaacattttgcgcgagtttgcgctagtcgcccccagacagggcctgtag

DBGET integrated database retrieval system