KEGG   Danio rerio (zebrafish): 494080Help
Entry
494080            CDS       T01004                                 

Gene name
tmprss2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dre01002]
    494080 (tmprss2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     494080 (tmprss2)
Peptidases [BR:dre01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   494080 (tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 Hepsin-SRCR Ldl_recept_a Trypsin_2 DUF316 SRCR
Motif
Other DBs
NCBI-GeneID: 494080
NCBI-ProteinID: NP_001008623
ZFIN: ZDB-GENE-041212-48
Ensembl: ENSDARG00000098686
UniProt: Q5PRA6
LinkDB All DBs
Position
10
AA seq 486 aa AA seqDB search
MNRTETIYDNVSHVNYGFHDEEQRPPPYAPSSGVNPALSQFPAPPNTQHLPQNPHVLYPS
QRYSPAHSLPHYTPQPALINTHHTVTPTIYLDTNPVNKVSRRKKWPYIVGTVVTLLVIAG
VVVAVLWFYGLFACLQGRMCEADKKCVSVSLWCDGTVDCPSGEDEAQCYRLYGPNFLLQK
YSNVSANWKNVCSDGFNDNLAKQACAEIGYKDTYSGYQGILSPSLDFISACQSSTAVSLK
CTDCGRSTGNRIVGGTTVTSKGVWPWQVSLHYSGRHLCGGSIITPYWILTAAHCVHQFSN
PGGWTVYAGYLTQSEMASASGNSVNRIVIHDFNPNTNENDIALMRLNTALTISTNIRPVC
LPNKGMSFTAQQDCYVTGWGALFSGGSSSATLQEAKIQLIDSTICNSRPVYNGLITDTMI
CAGKLAGGVDSCQGDSGGPLVTNVRSLWWLLGDTSWGDGCAVRNKPGVYGNVTYFLDWIY
QQMRKY
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaactgaaacgatctacgacaatgtctctcacgtgaactacggtttccatgat
gaggagcagcggccgcctccatatgcaccgtcttctggagtaaacccggctttatctcag
ttccccgcccctccaaacacgcagcatctgccccaaaatccccatgtgctttacccttca
caaagatactcacctgcgcacagcctgcctcactacacacctcaaccagcacttattaac
actcaccatacagtcacacctacaatctacctggacaccaatccagtcaacaaagtttcc
aggagaaaaaaatggccatatattgtgggcacagtcgtcacactgctggtcattgctgga
gttgtagttgcggtgctttggttttatgggttgtttgcgtgtttgcaaggacggatgtgt
gaagcagataaaaagtgtgtcagtgtgtcgctgtggtgtgacggtacggtggactgtccg
tcaggagaagatgaagctcaatgctatcgtctgtacggacctaatttcctccttcagaag
tactcaaatgtgagcgctaattggaaaaatgtctgttcagatggatttaatgacaacctg
gccaagcaagcctgtgcggagatcggatacaaggatacatattcgggttatcagggaatt
ttgtcgccatcgcttgacttcatttcagcctgtcaatcttccacagcagtgtcactcaaa
tgtactgattgtgggcggagcactgggaaccggattgtgggtgggaccacggtgacctca
aagggcgtgtggccatggcaggtcagcctgcattattccggaaggcatctgtgcggcggc
tccatcatcactccttactggatccttactgcggcgcactgcgttcatcagttttcaaat
ccagggggctggacggtgtatgctggatatctgacccaatcagagatggcgtcggcctcc
ggaaactctgtaaaccgaattgtcattcatgatttcaacccaaacaccaatgagaatgat
atcgcactaatgaggctaaacacagcactcactatttcaacgaacatcaggccagtctgt
ctgccaaataaaggcatgagcttcactgcgcagcaggactgttacgtcactggatgggga
gcgctgtttagtggaggctcttcctcagcaaccctacaagaggccaaaatccagctgatc
gacagcacgatttgtaacagccggcctgtgtataacggactgatcaccgacaccatgatc
tgtgctggaaagctggcaggcggcgtggactcctgtcagggggacagcggtggtcctctg
gtcaccaatgtgcgctctctctggtggctgctgggagacacgagctggggtgatggatgc
gctgtcagaaacaaacccggagtctacggaaatgtgacctacttccttgactggatctac
cagcaaatgcggaaatattag

DBGET integrated database retrieval system