KEGG   Danio rerio (zebrafish): 503869
Entry
503869            CDS       T01004                                 

Gene name
btc
Definition
(RefSeq) probetacellulin precursor
  KO
K09783  betacellulin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    503869 (btc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    503869 (btc)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   503869 (btc)
SSDB
Motif
Pfam: EGF EphA2_TM FAM176 Cadherin_C_2 CD34_antigen Syndecan Protocadherin LST1 PRIMA1 FAM163 Glycophorin_A TMEM154 TMEM119 Cytochrom_B558a Mid2 Vpu
Other DBs
NCBI-GeneID: 503869
NCBI-ProteinID: NP_001038229
ZFIN: ZDB-GENE-050311-1
Ensembl: ENSDARG00000098112
Vega: OTTDARG00000036596
UniProt: Q1LVQ0
LinkDB
Position
21
AA seq 178 aa
MDRTRRFIFAIISAVVLCKHSQAEWNATKAPANRTVSCEHHANSSNCTDSKDEQKWSGHF
SACPKEYKHFCIHGVCRFIEEQNTPSCRCEKGYIGSRCEYLDIDFHVGERRKIVIACVVA
GLVFLILLIVFICVCTHKRYRPCRKKKRKKQTIDEDDKHTPLNAHEGVPADTSNTNAV
NT seq 537 nt   +upstreamnt  +downstreamnt
atggacaggacgcgcaggttcatttttgcaataatctcagctgttgtcctatgcaaacac
tcccaggctgaatggaatgccacaaaagccccagcgaataggactgtgtcctgcgagcac
catgcaaacagcagcaactgcacagattcaaaagatgagcagaaatggagtggacacttc
tctgcctgtccaaaagaatacaagcatttctgcattcatggtgtttgccgtttcatagag
gagcagaacacgccgtcatgcagatgcgaaaaaggatatattggatcaaggtgtgaatat
cttgatattgatttccatgtcggagagcggaggaaaatagtcattgcgtgtgtggtcgca
ggattggtgtttctgattctgctcatcgttttcatttgcgtctgtacacataaacgatat
agaccatgtagaaaaaagaagagaaagaagcaaacaattgatgaagatgacaagcacact
ccgctaaacgcacatgaaggggttccagctgacacatccaacacaaatgctgtatga

DBGET integrated database retrieval system