KEGG   Danio rerio (zebrafish): 541530
Entry
541530            CDS       T01004                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04210  Apoptosis
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04623  Cytosolic DNA-sensing pathway
dre04625  C-type lectin receptor signaling pathway
dre04920  Adipocytokine signaling pathway
dre05132  Salmonella infection
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    541530 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    541530 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    541530 (ikbkg)
   04621 NOD-like receptor signaling pathway
    541530 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    541530 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    541530 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    541530 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    541530 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    541530 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    541530 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    541530 (ikbkg)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   541530 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 DUF1216 PRIMA1
Other DBs
NCBI-GeneID: 541530
NCBI-ProteinID: NP_001014366
ZFIN: ZDB-GENE-050327-68
Ensembl: ENSDARG00000017037
Vega: OTTDARG00000028122
UniProt: Q58EN3
LinkDB
Position
23
AA seq 586 aa
MVQPQPSGGCTLQYELNGEETAGSEGQVSLMASSQGSLRVPADLAGNEIVQKLITDNHQL
REALKRSNDALKERCEEMEGWQRRSREEREFLSCRFREARELVQRLAQENQSLLGQLNLS
VSQAGSLGISKETGSQDQELKCTNAEKNVLIDSPEVLNAAVLTECAEGDTDRHTMPQSLP
AVGSNDFLKLLKSHKEKLEEGMRALRRKNEELEKEKAENEKERENLLAALEQLRSKLSQN
VGVTEESVQPTCAVTVPAERYRELQEKLDCLQKNSFQRDRTEALLKQKEKEFVQVQKDSE
ALRSQVTSLLGELNERQNWLEKSEAEKRTLEDKLVTKSERLQTVEREMEQQKKQHSVTVD
NLLLKTQNLEAALKNERLVIVEERRKLAQLQHAYTCLFQDYDNKLKSEKQANHRGGEADT
LANRLGEAEKALALKQEHIDKLKEEMEQLRAKLETIPVLNHQAEIYKMDFLAEREAREKL
NQKKEELQEDLNKALVEIERFKQERTSRARIEEMQQRHLEDYRPRPHPPPPAAPFPGPAM
FNSAQPPSARRRDEDQEELPDYRCPKCMYKAPDMDTLQIHVMDCIQ
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggtccagccgcagccgtccggtggctgcactctgcaatatgagctgaacggagaagag
accgcaggttcagaaggtcaagtctcactcatggccagttcacagggctcattgagggtc
cctgctgatttagctggaaatgaaatcgttcagaaactcataacggacaatcatcagtta
cgtgaggctctgaaacgaagcaatgatgccctcaaagagagatgtgaagagatggagggc
tggcagaggaggtcaagagaagagcgagagttcctgagctgtagatttcgtgaggccaga
gagttagtgcagcgactggcccaggaaaaccagagccttttaggacaactaaacctgagt
gtcagtcaagcagggagtctgggaatctccaaagaaactggaagtcaagaccaagagctg
aagtgcaccaatgcagagaagaatgtcctcatagactcaccagaagtattaaatgcagct
gtactgacagaatgcgctgaaggagacactgacagacacacaatgcctcaaagtttgcct
gctgtgggctctaatgatttcctgaaactactgaaaagccacaaagagaagctggaggaa
ggcatgcgggctttaaggagaaagaatgaggagctggagaaggagaaagcagagaacgag
aaagagagagagaatctcctcgctgcactggagcagttgcgctccaaactgtctcagaat
gttggggttactgaagagtcagtccagccgacgtgtgctgtcactgttcctgcagaaagg
tacagggagctgcaggagaagctggattgtcttcagaagaattcttttcagagagacaga
actgaggctctccttaaacagaaggagaaagagtttgttcaggtacaaaaggacagtgaa
gcgctgagatcgcaagtaacgtcgcttctcggagagctgaacgaacgacaaaactggctg
gagaagagcgaagcagagaaacgaaccttagaagacaagctggtcacgaagagtgagcgt
ctgcagactgtagagagagagatggagcagcagaagaagcagcacagcgtgacggtagac
aatcttttactgaagacacagaatctggaagccgcactgaagaacgagaggctcgtcata
gtggaggagaggaggaagctggcccagctccagcatgcatacacgtgtctgtttcaggat
tatgacaacaaacttaaaagcgaaaaacaagccaatcacaggggtggagaggcggatacc
cttgctaacaggttaggggaggctgagaaagcactagccctcaaacaggagcacattgat
aaactcaaggaggaaatggagcagctgagagctaaattagagaccatacctgtgctgaac
catcaggcagagatctataagatggacttcttggctgagagggaagccagagagaaactc
aatcaaaagaaggaagagttgcaggaggatctgaataaggcattggtcgagattgaaaga
ttcaagcaagaaagaacctcacgagctcgcattgaagagatgcagcagagacacttggag
gactacaggcctcgacctcacccgccacctccagctgcacctttcccagggccagcgatg
ttcaattcagcccagcctccatctgcacgcagaagagacgaagatcaagaagagctgcca
gattacagatgccccaaatgcatgtacaaggcaccagacatggatacgctgcagattcac
gtcatggactgcatccagtga

DBGET integrated database retrieval system