KEGG   Danio rerio (zebrafish): 541539Help
Entry
541539            CDS       T01004                                 

Gene name
alpi.1
Definition
(RefSeq) intestinal-type alkaline phosphatase precursor
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00730  Thiamine metabolism
dre00790  Folate biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    541539 (alpi.1)
   00790 Folate biosynthesis
    541539 (alpi.1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    541539 (alpi.1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dre00537]
    541539 (alpi.1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     541539 (alpi.1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   541539 (alpi.1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dre00537]
 Enzymes
  541539 (alpi.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 541539
NCBI-ProteinID: NP_001014375
ZFIN: ZDB-GENE-050327-78
Ensembl: ENSDARG00000015273
Vega: OTTDARG00000011512
UniProt: Q58EF1
LinkDB All DBs
Position
22
AA seq 532 aa AA seqDB search
MCLVYGRAPGALLLLLLALVLNTSCSLDSAAEWEKDPAYWNDQARRTLQTALTLPLRVNR
AKNIILFVGDGMGVSTVSAARILRGQMEGQSGEETILAMDTFPYLALSKTYCVDKQVADS
ASTATAYHCGVKANAKTVGLSAKAVAYECNTTFGNEVFSVLHRAKAQGKSVGIVTTTRVQ
HASPAAAYAHSVSRKWYSDADVPSEARRQGCKDIATQLVTNTDIDVILGGGRMYMTPKGT
PDPEYSSSSHKGDRKDKKNLINVWLNARKGRNAQYVWNKEQFNAVDVKTTDCLMGLFEPK
DMRFEVFRNRTRDPSIVDMTEKAIQILSKNPKGFFLFVEGGRIDHGHHDGVAKLALTETI
MFDRAIQRASELTSESDTLTVVTADHSHVFTFGGKTPRGNPIFGLAPKQAEDDLPYTSIL
YANGPGYDHVNGTRGNVSVLDYYDEEYKQQAAVPLESETHGGEDVAIYAKGPMAHLFHGV
KEQNYVAHAMAYAACLEPYTNCPLDLYSSAGWKTPLSLTLISLTGVFWLVLR
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttggtttacggtcgggcccccggagcgcttcttctcctcctgttggccctcgtc
ctgaacaccagctgcagtctggactccgcggctgaatgggagaaggatcccgcatactgg
aatgatcaggccagacggacgctgcagacggccctcacgctgcctctcagagtcaaccga
gccaaaaacatcatcctcttcgttggtgatggaatgggagtgtccacggtttcagccgct
cgtatcctgcggggtcagatggaaggacagtccggggaggagacgattctggccatggac
acgtttccatatctcgccctgtcaaagacatattgtgtggacaagcaggtcgcggacagc
gctagcacagctacagcgtatcactgcggagtgaaggctaatgccaagacggtgggcttg
agtgccaaagcagtggcctacgagtgcaacacaacatttggcaatgaggttttctcagtg
ctgcaccgcgccaaagcacaaggaaagtctgttggcatcgtgaccaccaccagagtccag
cacgcgtcgccggctgctgcgtatgcgcattcagtcagccgtaaatggtacagcgatgca
gatgtgccctccgaagcccgccggcagggctgcaaagacatcgccacacagctggtgacc
aacactgacattgatgtcattcttggaggtggccggatgtacatgacacccaagggaacc
cctgacccagaatactcctcatcatctcacaaaggagatcgaaaagacaaaaaaaatctt
attaacgtttggctcaatgcccgcaagggaagaaacgcccagtacgtttggaacaaagag
cagttcaatgcagtagatgttaaaacaacagactgcctgatgggcctgtttgagcccaaa
gatatgagattcgaggtgttcaggaatcgtacacgtgatccttccatcgtggacatgact
gagaaagccattcaaatcctcagcaagaaccctaaaggcttttttctctttgtggaagga
ggcagaatagaccacggacaccacgacggggtggccaaacttgctctgacagagaccatc
atgttcgaccgggcgattcagagagcgtccgagctgaccagtgaatcagacacgctcact
gtcgtcaccgcagatcattcccatgtcttcacctttggtggaaaaactcctcgggggaac
ccaatttttggtctggcacctaaacaggctgaagatgatcttccatacactagtatcttg
tatgcgaacgggccaggatacgatcatgtgaacggaacaagaggaaatgtttccgttttg
gattattatgatgaagagtacaagcaacaagctgcggttcccttagaatccgagacacac
ggaggggaagatgtggctatctatgccaaaggcccaatggcacacctctttcatggagtc
aaagagcagaactatgtggcccatgccatggcttacgcagcgtgccttgagccgtacacc
aactgcccgctggatctgtacagctctgcaggctggaaaacccctctttcattgactctg
atctctctaaccggcgtgttttggcttgttttgagatga

DBGET integrated database retrieval system