KEGG   Danio rerio (zebrafish): 553179
Entry
553179            CDS       T01004                                 

Gene name
kitlga
Definition
(RefSeq) kit ligand a precursor
  KO
K05461  KIT ligand
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    553179 (kitlga)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    553179 (kitlga)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    553179 (kitlga)
Cytokines and growth factors [BR:dre04052]
 Growth factors
  Growth factors (RTK binding)
   553179 (kitlga)
SSDB
Motif
Pfam: SCF DUF3439
Other DBs
NCBI-GeneID: 553179
NCBI-ProteinID: NP_001018133
ZFIN: ZDB-GENE-070424-1
Ensembl: ENSDARG00000070917
Vega: OTTDARG00000028394
UniProt: Q56JH6
LinkDB
Position
25
AA seq 272 aa
MKKSNIWICTCVHLLLYITVAAYSIEIGNPITDDIKKISLLKQNIPKDYKITVRYIPKEV
SGMCWVKLNVFHLEVSLKGLAQKFGNISSNKDNIGTFVQILQDMRYHIGPGLEDSMLDFE
CHYVEEMWLTAKYFEFLEDFFNTANSSRDAEDCEPPPCPTSTKTTITTTTTASTTSAQHS
TNEKRNGLPDDPEKGAFLSKVLESNLMWLLTIPFAIAVVVLLVWKIKSRRNTPQTDRSPE
EGPALFSGEEANISPLDVGISEKNRLNIIMDV
NT seq 819 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaacatttggatatgcacctgtgtccatttattgctgtacatcacagtt
gctgcctattccattgaaataggaaatcccattacagatgacatcaagaagatttctttg
ttgaaacagaatattccaaaagactacaagattacagtgcgttatatacctaaagaagtg
agtggcatgtgctgggtgaagctaaatgtatttcacttggaggtgagcttaaaaggcctg
gcgcagaagtttgggaacatatcctccaataaagataatataggcactttcgtccaaata
ctgcaagatatgcggtatcacattggacctggtttggaggattcaatgcttgactttgag
tgtcactatgtagaggagatgtggcttacggcgaagtattttgaatttttggaggatttt
ttcaacactgccaattcatcaagagatgctgaggactgcgagccaccgccatgtcccaca
tccacaaaaacaacaataacaacaactacgacagcgtcgacaacatcagcgcaacatagt
acaaatgagaaacgaaacggtttgcctgatgaccccgaaaaaggggcatttctttcaaaa
gttttggagagtaatctcatgtggctcctcaccatcccgtttgcaatcgcagtggtggtt
ttgctggtctggaagattaagtccagaagaaacaccccccaaactgaccggagtccagaa
gaaggtcccgctctgttctcaggagaggaagccaatatatcgccattagatgtggggata
tctgaaaaaaacagattaaatattatcatggatgtgtaa

DBGET integrated database retrieval system