KEGG   Danio rerio (zebrafish): 553181
Entry
553181            CDS       T01004                                 

Gene name
kitlgb
Definition
(RefSeq) kit ligand b
  KO
K05461  KIT ligand
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    553181 (kitlgb)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    553181 (kitlgb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    553181 (kitlgb)
Cytokines and growth factors [BR:dre04052]
 Growth factors
  Growth factors (RTK binding)
   553181 (kitlgb)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 553181
NCBI-ProteinID: NP_001018137
ZFIN: ZDB-GENE-070424-2
Ensembl: ENSDARG00000058042
Vega: OTTDARG00000033679
UniProt: Q56JH5
LinkDB
Position
4
AA seq 267 aa
MFHMREVKIGESICVLVLLFSGLVTCSGVFGSPLTDDVATLDTLSENIPSDYRIPIKFIT
KDVGGACWLHLNLYPVESSLKKLAVKFGNQSTNKANITIFITMLQDFRFTLNSDDLEDRM
QAFKCHYRREKWPTRRFFSYVKSVLTVAGSTYGDIPPCTPPPCQTLAAPPFTPGQSRQQN
GMNSAVHGLLALLIIPSVAILVLTIQMALGRRGRCGARMREIEPHDRAEENRNELHSGAA
QEDPASTSASEQDRAWLDSLGCADTEV
NT seq 804 nt   +upstreamnt  +downstreamnt
atgttccacatgagggaggttaagattggagaaagcatttgtgtattagtgttgcttttt
tcggggcttgtgacctgctcaggtgtttttgggagccctttaacagatgatgtggccacg
ttagataccctgagtgagaatattcccagtgactacagaatacccatcaagttcatcaca
aaggatgtgggtggagcttgctggctgcatttgaacctgtatccagtcgagagcagttta
aaaaaattggcagtcaagtttggcaaccagtccaccaataaggccaacatcaccattttc
ataacaatgctgcaggattttcgtttcactctgaacagtgacgacctggaggacagaatg
caagccttcaagtgccactacagaagggaaaagtggccgactaggcgcttctttagctat
gttaaatccgttcttacagtggccggctccacatatggtgatattcctccatgcacacct
cctccttgccagacccttgcagctcctcctttcacgccaggtcaaagcagacagcagaat
ggcatgaactctgcggttcatgggctcctggcgctgctcatcatccccagtgtggctatt
ctagttctcactatccaaatggcattaggaagaagaggtcgttgtggagcaagaatgcgt
gaaattgagcctcacgacagagctgaagaaaacagaaatgagctccacagcggagctgca
caggaggacccggcttccacctccgccagtgaacaagacagggcgtggctggattcttta
gggtgtgcagacacagaggtctaa

DBGET integrated database retrieval system