KEGG   Danio rerio (zebrafish): 553740
Entry
553740            CDS       T01004                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    553740 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    553740 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dre03310]
    553740 (nr3c1)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    553740 (nr3c1)
Nuclear receptors [BR:dre03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   553740 (nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 553740
NCBI-ProteinID: NP_001018547
ZFIN: ZDB-GENE-050522-503
Ensembl: ENSDARG00000025032
Vega: OTTDARG00000022489
UniProt: Q1XHK0
LinkDB
Position
14
AA seq 746 aa
MDQGGLENGKKRDERLNTLDYNKRATEGILPRRIQSTMSVAPTSMVPQAGPMMQPVSGDI
PNGLSNSPTLEEHTSSVSSIFGDDSELKLLGKEQRALQQQTLVPFTLGDSLSGLEASIAD
LNNPSPSMDSLIGGVDPNLFPLKTEDFSPMIKGDMDLDQDSFGHIGKDVDVGNHKLFSDN
TLDLLQDFELDGSPSDFYVADDAFLSTIGEDALLSELPTNLDRDSKAAVSGSNTLNGTAS
SSLSTANTSILPNIKVEKDSIIQLCTPGVIKQENTGASYCQGGLHSTPINICGVTTSSGQ
SFLFGNSSPTAVVGLQKDQKPDFNMYTPLTSSGDGWSRSQGFGNVSGMQQRASLCFSKNF
SSSPYSRPEDSTATSSAGGKTGTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHN
YLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLEARKSKSKARQAGKVIQQQSIPERNL
PPLPEARALVPKPMPQLVPTMLSLLKAIEPDTLYAGYDSTIPDTSVRLMTTLNRLGGRQV
ISAVKWAKALPGFRNLHLDDQMTLLQCSWLFIMSFGLGWRSYQHCNGNMLCFAPDLVINE
ERMKLPYMSDQCEQMLKISNEFVRLQVSTEEYLCMKVLLLLNTVPKDGLKSQSVFDELRM
SYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMHDLVGGLLNFCFYTFVNKSLSVEFPE
MLAEIISNQLPKFKDGSVKPLLFHQK
NT seq 2241 nt   +upstreamnt  +downstreamnt
atggatcaaggaggactggagaatggcaaaaagcgagatgagcgtttaaatacattggat
tacaacaaacgagcaactgaggggatattaccaagaagaatacaaagcaccatgtctgtg
gcccctacatctatggttcctcaagccggtccaatgatgcagccagtttctggggacatt
cccaatggcctgagcaattcgcccactctggaggagcacaccagctcggtgtcctccatc
tttggcgacgattccgaactcaaactgcttgggaaggagcagagggccctgcaacagcag
accttggtccccttcactttgggtgacagtctttcaggtctggaggccagcattgcagac
cttaacaacccctctccctcaatggattccctgattggtggagtcgatcccaatcttttc
cccttaaaaacagaggacttttctcccatgattaaaggcgatatggaccttgaccaagat
tcctttggacacattgggaaagatgttgatgttggcaatcataagctctttagtgacaac
actctggacctcctgcaggactttgagctggatggatcgccatcagacttctacgttgct
gacgatgcgtttctctccaccataggtgaagatgctctcctttcagagctgccgacaaat
ttagacagggactcgaaggctgcggtttccgggagcaacacgctcaatggcacagcttct
tccagcctcagcacagccaacaccagcatcttgcccaatataaaggtggagaaagactct
ataatccagctgtgcaccccaggggtcatcaaacaggagaacaccggtgcgagctattgt
caaggagggctccacagcacccccattaacatatgcggggtcaccacttcaagcggacag
agcttcctctttgggaacagctcgcccacagctgtcgtcggtctgcagaaagatcagaag
ccggactttaacatgtacacccctctgacctcttcaggagatggttggagcaggagccag
ggctttgggaatgtcagtggaatgcagcagagggccagtttatgcttttccaaaaacttc
tcaagcagcccctattccaggcctgaagacagcactgccacatcgtcagctggtggaaag
actggcacacacaagatctgtctggtttgctcagatgaggcttctggctgccattatgga
gttctcacttgcggaagctgtaaagtcttctttaaaagggctgttgaagggcaacacaat
tacctgtgtgctgggcgaaacgattgcatcattgacaaaatccgccggaagaactgccct
gcctgtcgtttccgcaaatgcctcatggcaggcatgaacctagaggcacgtaaaagcaag
tcaaaggcacgtcaagccggaaaggtaatccagcagcagtccattccggagcgcaacctt
cctccactgccggaggcccgcgcactggtgcccaaaccaatgcctcagctggtgcccact
atgctatcactactaaaggccattgagccagacaccctctatgccggatatgacagcact
ataccagacacatccgtccgcctcatgactacgttgaacaggctgggtggccggcaggtc
atctctgctgtcaaatgggctaaagctctgccagggttccggaaccttcatctggatgat
cagatgaccctcctgcagtgttcctggctgttcatcatgtcttttggactgggctggagg
tcctaccagcactgtaacggaaacatgctgtgtttcgctccagacctggtgatcaatgaa
gagaggatgaagttgccctacatgagtgatcagtgtgaacagatgttgaagatctccaat
gaatttgtgcgactgcaagtgtccactgaggagtatctgtgcatgaaagtccttctgctc
ctgaacacagtgccgaaggatgggttgaagagccagtcagtgtttgatgaactacgaatg
tcttacattaaagaattgggcaaggctattgtgaagagagaggagaactccagccagaac
tggcaacggttctatcagctcactaagctactggactccatgcacgacttggtgggtgga
ctcctgaacttctgcttctacacctttgtgaataaatctctgagcgtggagtttcccgaa
atgcttgcagaaatcatcagcaaccagttaccaaaattcaaagatgggagtgttaaaccg
ctgctctttcaccagaaatga

DBGET integrated database retrieval system