KEGG   Danio rerio (zebrafish): 556286
Entry
556286            CDS       T01004                                 

Gene name
sos1
Definition
(RefSeq) son of sevenless homolog 1
  KO
K03099  son of sevenless
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04150  mTOR signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    556286 (sos1)
   04012 ErbB signaling pathway
    556286 (sos1)
   04068 FoxO signaling pathway
    556286 (sos1)
   04150 mTOR signaling pathway
    556286 (sos1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    556286 (sos1)
   04540 Gap junction
    556286 (sos1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    556286 (sos1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    556286 (sos1)
   04912 GnRH signaling pathway
    556286 (sos1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    556286 (sos1)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   556286 (sos1)
SSDB
Motif
Pfam: RasGEF Histone
Other DBs
NCBI-GeneID: 556286
NCBI-ProteinID: NP_001076462
ZFIN: ZDB-GENE-070209-128
Ensembl: ENSDARG00000100503
Vega: OTTDARG00000043150
UniProt: A2RRV5
LinkDB
Position
11
AA seq 713 aa
MQAPPFQYDFYSEENAHKWRGLLVPSLNKVLNQVHPKLSSQQEALQYIEGLILVLLNTLC
QAQPRTVQDVEERVQRSFPHPIEKWAIADAQAAIEKRKRRNPLALPVDKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEISQQDITVAMCADKVLMDMLHPIE
IARQLTLLESDFYRAVQPSELVGSVWTKEDKEINSPNLLRMIRHTTNLTLWLEKCIVETE
NVEERVSVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQRKILEE
AHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGTELINFSKRRK
VAEITGEIQQYQNQPYCLRVENDIRKFFENLNPMEDMMEKEFTDYLFNKSLEIEPRNART
LPRFAKKYSCPLKSPGVRPSAVRPGAMRHPTPLQNEPRKISYSRIPDSETESSAASAPNS
PRTPLTPPPASAASTDTCSVFDSPQQPSSPFHSNSECVFAPVALPHGPRSSSVSSMMGFL
RNDDPPVPPPVPPRRRPESAPAESSPSKMMSTHLDSPPAIPPRQPTSSKVYSPRYSLTDP
PESPPLLPPREPVRTPDVFCSSPLHLQPPPPGRRAPELQAFFPPQTPSPSPLGPRKHPEP
PPEPPLGPPVPPRLSTAGPPAHIPKLPPKTYKRESVHREGPPPPLLLENANPT
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgcaggctccgccctttcagtatgacttctacagtgaggagaacgcgcacaagtggaga
ggcctgctggtgccgtcactcaacaaggtgcttaatcaggtgcacccgaagctgtcgtcc
cagcaggaggcgctgcagtacatcgaggggctgatcttggtgctgctcaacacactctgc
caggcacagcctcgcactgtacaggatgtggaggagcgtgtgcagaggagttttccacac
ccgatagagaaatgggcgatcgcagatgctcaggccgccatcgagaagaggaagaggagg
aacccgctggcgctgcccgtggacaagatacatccactgctcaaggaggttctgggctat
aagatcgaccaccaggtgtcggtgtacatcgtggcggtgctggagtacatctctgcagac
atactgaagctggctggaaactacgtcagaaacatccggcactatgagatctcacagcag
gacatcactgtggccatgtgtgctgataaggtgctgatggacatgctccaccccatcgag
atcgcccgccagctcacactgctggagtctgacttctacagggcggtgcagccgtcagag
ctggtgggaagcgtctggactaaagaagataaagagatcaactctccaaacctgctgagg
atgatcagacacaccaccaacctcacactctggctggagaagtgtatagtggagacggag
aatgtggaggagcgtgtgtccgtggtgtcgcgtatcattgagatcctgcaggtctttcag
gagctcaacaacttcaatggtgtgctggaggtggtgagcgccatgaactcctcacccgtc
tacaggctcgaccacaccttcgagcaaatccccagcagacagaggaagatcctggaggaa
gctcatgagctcagtgaagatcattataagaagtatctggccaagctcaggtccatcaac
ccaccctgtgtgcccttctttggcatttatttaacgaacatcttgaagacggaggaggga
aacccagacttcctgaagcgccacggcactgagctgatcaacttcagcaagaggaggaaa
gtggctgagattactggagagatccagcagtaccagaaccagccctactgtctgcgggtg
gagaacgacatccggaagttcttcgagaacctaaacccgatggaggacatgatggagaag
gagttcacagattacctgttcaacaaatctctggagatcgagccgcgcaatgcacgcaca
ctgcccagattcgccaagaagtacagctgtcctctgaagtctccgggggtccgtccgtcc
gcggtgcggccgggagcgatgcgacacccgacgccgctgcagaacgagccgcgcaagatc
agctacagccgcatccctgacagcgagacggagagcagcgcagcgtctgcaccaaactcc
cccagaacacccctgacacccccacccgcatccgctgcatccactgacacctgcagtgtg
ttcgactctccacagcagccctccagcccgttccactccaacagcgagtgtgtgttcgct
ccggtggctctgccgcacggcccacgatcctcttcagtgtcctctatgatgggttttctg
aggaatgatgatcctccagttcctcctcctgtcccgccgcgccgccggcccgagtctgcc
cccgccgagtcctcgccctccaagatgatgtcaacacacctggacagtcctcctgcgatt
ccccctcgtcagccgaccagcagtaaggtgtattctcctcgatactcgctgacggatcct
ccggagagcccacctctgctgccgccgcgggagccggtgcggaccccggacgtgttctgc
agctcgccgttacacctgcagccgccgccgccgggccgccgcgcccccgagctgcaggcc
ttcttcccaccacagacgccctcaccgtcaccgctggggccgcggaaacacccggagccg
ccgccggagcccccactggggccgcccgtccccccacgcctcagcaccgccggcccgccc
gcacacatccccaaactgcccccaaaaacatacaagagggagtcagtgcaccgcgagggt
ccgccgccgccactgctgctggagaacgccaaccccacatga

KEGG   Danio rerio (zebrafish): 561670
Entry
561670            CDS       T01004                                 

Gene name
sos2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04150  mTOR signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    561670 (sos2)
   04012 ErbB signaling pathway
    561670 (sos2)
   04068 FoxO signaling pathway
    561670 (sos2)
   04150 mTOR signaling pathway
    561670 (sos2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    561670 (sos2)
   04540 Gap junction
    561670 (sos2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    561670 (sos2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    561670 (sos2)
   04912 GnRH signaling pathway
    561670 (sos2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    561670 (sos2)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   561670 (sos2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH
Other DBs
NCBI-GeneID: 561670
NCBI-ProteinID: NP_001334612
ZFIN: ZDB-GENE-090319-5
Ensembl: ENSDARG00000060506
Vega: OTTDARG00000029600
UniProt: F1R019
LinkDB
Position
13
AA seq 1341 aa
MQHDFSSSEENSARWRGLFVQGLRKVQVQVHPNLSAKEDALQHIEALILQLLNKLCVTQP
RTIADVEDRVQKTFPNPIDKWAMGDAQNAIEKRKRRNPLLLPVDKIHPLLKEVLGYKIDY
NVCLYIVAVLEYISADILKLAGNYVSNIRHYEISQQDITVSMCADKVLMDMFDQEEEMGL
LSQSVEEVSSSGVLTYDDLVRLEIAEERQYLRELDLIIKVFRQAFMSNSKLFSAQDVELA
FSNILEVQELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQDILSK
EFCQHFNTLMSRPTVALHFQSIAEGFKEAVQYVLPQLMMVPVYHCIHYFELLQQLQECSE
EQDDRECLKQAQTALINLQCSIERIYAKHQPRRKQGEPLYRLYSRASRSKQAAIKRMNDI
QKSIDGWEGKDIGQCCSQFILEGALLRAGAKHERHNFLFDGLMISCKANQSSRLPGAGSG
AEFRLKEKFVLRKYRIVDREDSPEFRHAFELVGREESGAVFSARSAEEKSAWMAALVTLQ
YRPTLDRMLDTVLHREEQAQPLRLPSPDVYRFAIQDSEENIVFEEGAQSKTGIPIIKAGT
VVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQDLLTLLIERIEIPEPEPSEADREALWN
GEQPMAAELQRFRREYVQPVQLRVLNVFRQWVEHHFYDFENDPELYERLEGYLISTTQLR
GKSMRKWVESISKIMRRKIQMQSNGISHNITFESPPPPIEWHISRPGQVDTFDLMTLHPI
EIARQLTLLESDLYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFEKCIVEA
ENVDERVAVFSRIIEILQVFQELNNFNGVLEIVSAINSVPVYRLDHTFEAVPERKRRILE
EAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRDGKELINFSKRR
KVAEITGEIQQYQNQPYCLKVEHDIKRFFENLNPMGNMNEKDFSDYLFNKSLEIEPRNSK
QPPRFPRKTTYSLKSPGVRPVRQAVGGGGTLKGHPVPLEREPPHKITFRSIAETEPETPP
SLPTSPNTPTPPQSASSDFNSVFEQDFMPYGNNTIFAPVFLPQSKFQSVSCGSLHQLMSD
EPLKPPPLPPRRKDTSSDKNSRSDSPPAIPPRLPPPPRLQPRVPVINGPTDGPLPSPPPP
LPRDPLPDTPPPVPQRPPEIFINYPVNMQPSPGGRFHWDFTTSPSTPNTPPGTPSPRAVL
PGTPSPRVPRRPCTPSVSQPILVHLPPPTPAPPIPPRHNSTSALPKLPPKTYKRELSQSS
HTLSQPSLHTLSLVDNRDSNE
NT seq 4026 nt   +upstreamnt  +downstreamnt
atgcagcacgacttcagctccagcgaggagaacagcgcgagatggcgaggcctgttcgtg
caggggctgcgaaaggtgcaggtgcaagtgcatccaaacctgtcggctaaagaagatgca
ctccagcacattgaggcacttatactgcagctcctgaacaagctgtgtgttacacagccc
agaacaatagctgatgtagaggaccgcgtccagaagacgttcccaaatcccatcgataaa
tgggccatgggtgacgctcagaatgcaatagagaaacgcaagcgaagaaacccgctgctg
ctgccagttgataagatacatccactactgaaggaggtgctgggctataagatcgactat
aatgtgtgtctatatattgttgctgtgctggagtacatctcagctgacatcctcaagctg
gctggaaactacgtgagcaacattcgacattatgagatcagccagcaggacatcactgtc
tccatgtgtgctgataaggtgttaatggatatgttcgatcaagaagaggagatggggctg
ttgtctcagagtgtggaggaggtgtcttcatctggtgtgctcacatatgatgacctggtg
cgtctggagatcgcggaggagcgtcagtatctgcgggagctcgatctcatcatcaaagta
ttccgccaagcctttatgtccaatagcaaactcttctccgctcaggatgtggagctggcg
ttcagtaatattctagaggttcaggagttaacagtgaaactgttgggtcttattgaggat
gcggtagaaatgacagctgacgggagtccacaccctcttgtgggcagctgctttgaagac
ctcgctgaagagcaggcatttgatccctatgagacgctctctcaggacatcctctctaaa
gaattctgtcaacatttcaacacactgatgtcccgccccactgtagctctgcacttccag
tcaattgcagaaggctttaaggaggcagtgcagtacgtgcttcctcagttgatgatggtt
ccagtttaccactgcattcactattttgaactgttacagcaattgcaggagtgcagtgaa
gagcaagatgacagagagtgtttgaaacaggcacagactgcactgatcaacctacaatgc
agcattgaacgcatatatgctaagcaccaaccacggcgcaaacaaggggaaccactgtat
cgattgtatagtcgtgcatctcgtagcaagcaggcggctataaagcgtatgaacgacatc
cagaagagtattgatggctgggagggcaaagacattggtcagtgttgtagccagttcatc
ctggagggggcactccttcgggctggtgccaaacatgagcggcacaactttctattcgat
ggcctcatgataagctgcaaagccaatcagagctccaggttgccaggagcaggcagtggg
gcagagtttcgtctgaaagagaagttcgtgttacgcaaatatcgcattgtagatcgcgag
gattcaccagagttccgtcatgcatttgagctggtgggccgtgaggaaagcggagcagtg
tttagtgcccgttcagcagaagaaaagagtgcatggatggctgcgctggtcactctgcag
taccggcccacactggaccgcatgctggacactgtcctgcaccgtgaagaacaagcacaa
ccactgaggctgccatcaccagacgtctaccggttcgccatccaggactccgaagagaat
atcgtgttcgaggaaggagcacaaagcaagactggaatccccattattaaagctgggaca
gtggtcaagctcattgagagactgacgtaccacatgtacgcagacccaaattttgtgcgt
acgtttctgactacataccgctctttctgcaaaccacaagacctgctcacactactgatt
gaaaggattgagattccagagcccgaaccatcagaagcagatcgagaagctctctggaat
ggagaacaaccaatggcagctgagcttcagagatttcgcagagaatacgtgcagcccgtc
caactcagggtcttgaatgtgttccgtcagtgggtggaacatcacttttatgactttgag
aatgatcctgaactctacgagagacttgaaggatatcttatcagcaccacacagcttaga
ggtaaatctatgcgtaagtgggtggagtctatcagtaagatcatgagacggaagatacaa
atgcagtctaacggcattagtcacaacattacctttgagagcccacctccacccatcgaa
tggcacatcagtcgccctgggcaggtcgacacctttgacctcatgacccttcatccgata
gaaattgctcgccagttaacacttctggagtctgatctgtacagagctgttcgtccgtct
gagctcgtaggaagtgtttggacaaaggaagataaagagaagaactctcccaatctgctg
aggatgatcagacacacaaccaatctcacactgtggtttgaaaagtgtatagtagaggct
gaaaatgtagacgagagggttgctgtattttctcgcattattgagatcctgcaggtgttt
caagagcttaataactttaatggggttttggagattgtgagcgccatcaattctgtaccg
gtgtatcgtctggaccacacatttgaggcagtgcctgagaggaagaggaggattctagaa
gaagctgttgaactcagtcaggatcattttaagaaatatctcgccaaactcaagtccatc
aacccaccctgtgtacctttctttggtatctacctgactaacattctgaagactgaagag
gggaatccagatttcctaaagcgggacggaaaagaactgatcaacttcagcaagagacgc
aaagtagcagaaatcactggagaaatccagcagtaccagaaccaaccctactgcctcaaa
gtggaacacgacataaagaggttttttgagaatctgaatccaatggggaatatgaatgaa
aaggatttctctgactatttgttcaataagtctttagaaatcgaaccacggaacagcaag
cagccacctagatttcccagaaagactacatattctctgaagtctccgggcgttcggcct
gtgcgccaggcggtaggtggaggagggacgctaaaaggtcacccagtgccattagaaaga
gaaccacctcacaaaatcaccttcaggagcatcgcagaaactgaacccgagacgcctccc
tctctgcccacctctccaaacacacccacccctccgcagtccgccagctctgacttcaac
tctgtgtttgagcaggacttcatgccctacggtaacaacaccatatttgccccagttttt
ctgccgcagtccaagttccagtctgtgtcatgtggtagtttacaccagttgatgagtgat
gagccactcaagccccctccattacctcctcgcaggaaagatacttcttcagataagaat
tccaggtctgacagtcctcctgccattccaccacgattgcctcctcctccccgcctgcag
ccgcgtgtcccagtgatcaacgggccgacggatgggcccttgccgagccccccaccacct
ctgccccgtgacccccttccggacactcctccaccagtgccccagagaccacccgagatc
ttcatcaactacccagtgaacatgcagccatctccagggggccgtttccactgggacttc
accacctcacctagcactcctaataccccgcctggcaccccctctccccgtgctgtcctc
cctggaaccccttctccacgtgtgccccggcgcccctgcacacccagcgtcagtcaaccc
atactggttcaccttcctcccccgacaccggcacctcccatcccgcctcggcacaactcc
acctccgccctgccaaaactgccacccaagacttacaaaagagaactgtctcaatcttca
cacactctttctcagccctccctacacacactctcgctagttgacaacagggacagcaac
gaataa

DBGET integrated database retrieval system