KEGG   Danio rerio (zebrafish): 557095Help
Entry
557095            CDS       T01004                                 

Gene name
kcnj3b
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 1
  KO
K04997  potassium inwardly-rectifying channel subfamily J member 3
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    557095 (kcnj3b)
Ion channels [BR:dre04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   557095 (kcnj3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK
Motif
Other DBs
NCBI-GeneID: 557095
NCBI-ProteinID: XP_005165913
ZFIN: ZDB-GENE-120215-38
Ensembl: ENSDARG00000062217
Vega: OTTDARG00000037935
UniProt: E7F1N1
LinkDB All DBs
Position
6
AA seq 539 aa AA seqDB search
MSALRKKFGDDYQVVTTSSSGGGFNQAAPEKKRKRQRFVDKNGRCNVQHGNLGGETSRYL
SDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAFIRGDMNQAHDDKYTPCVANVY
NFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPK
KRAETLMFSEHAAISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQ
LELDVGFSTGADQLFLVSPLTICHVIDSKSPFYDLSLRSMQTEQFEIVVILEGIVETTGM
TCQARTSYTEDEVLWGHRFYPVISLEEGFFKVDYSQFHGTFEVPTPPHSVKEQEESLLLS
SPLTAPSLCHSAGGVTEGSGTLEGLELQSDAETGSINIATPMPTNKLPAKLQKLTGREVP
IRDGMPRKLLRMSSEITYNLGDLPVKLQRISSAPGVAEERLQPISSMLSPTEDRLAPKLG
LIGGAETISQSVTDLPPKLQRLAGGVGVGGVGIGGRMDGHLPPKLRKMNSERFTGLSLK
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgttgaggaaaaaatttggggatgattatcaggtggtgaccacctcgtccagc
ggcggcgggttcaaccaagcggcccccgagaagaaaaggaaacgtcagcgctttgtggac
aagaacggccgctgtaacgtccagcacgggaacctgggaggagagacgagccggtacctg
tccgacctgttcaccacgctcgtggacctcaaatggcgctggaaccttttcatcttcatc
ctcacatacacggtggcgtggctcttcatggcttctatgtggtgggtcattgcttttata
cgcggagacatgaaccaggcccacgacgacaagtacacgccgtgcgtggccaatgtgtac
aactttccctccgcttttctgttcttcatcgagaccgaggccactatcggatacggttac
cgctacattacagacaagtgtccggaaggcatcattctcttcctcttccagtccatccta
ggctctatagtggacgcttttctaatcggctgcatgttcatcaagatgtcccagccgaag
aaacgcgcggagacgctcatgttcagcgagcacgcggcgatttccatgcgtgacggcaaa
ctgaccctgatgttccgcgtggggaacctgcgcaacagccatatggtctccgcgcaaata
cgctgcaaactgctcaaatcccgtcagactcccgagggcgagtttttgcctctggatcaa
cttgagctggatgttgggttcagtaccggagctgaccagcttttcctagtgtctcctctg
acaatctgccatgtgatcgactccaagagcccattctacgacctctcgctcaggtccatg
caaacagagcaatttgagattgtggttatcttagaagggatcgtggagaccaccggtatg
acatgccaggctcgtacttcctacacagaggacgaggttctgtggggtcaccgattctat
cctgtcatttctctggaggagggattcttcaaggttgactattcgcagtttcatggcact
tttgaggttcccacaccaccgcacagtgttaaagaacaggaggagagtctgctgctgtcg
tcccccctgacagccccctctctgtgccacagcgcaggtggggttacagagggcagtggc
acactggaaggtctggagcttcaaagcgatgcagaaactggctccatcaatattgcaacc
ccaatgccaaccaacaaactgcctgccaaacttcagaagctcacaggacgggaggtcccc
attcgggatggaatgccccgtaagcttctgcgcatgagctcggaaatcacctacaacctg
ggcgacctgcccgtcaaactccagcgaatcagctcagctccgggcgtggcagaagagagg
cttcagccaatcagttccatgctgagccccacagaggacagactggctcccaagctgggc
ttaataggtggagctgaaactatcagccaatcagtgacagatctgccgccaaaactgcag
aggttggctggcggggtcggggtgggaggagtcggaatcggaggacgaatggatggtcat
ctgcctcccaaactaagaaaaatgaactctgagaggttcacaggcttgagtttaaaatga

DBGET integrated database retrieval system